KEGG   Agrobacterium fabrum: Atu3578Help
Entry
Atu3578           CDS       T00070                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
atu  Agrobacterium fabrum
Pathway
atu00564  Glycerophospholipid metabolism
atu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Atu3578 (glpD)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Atu3578 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C STPPase_N NAD_binding_8 FAD_oxidored Pyr_redox_2 FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1135452
NCBI-ProteinID: NP_357034
UniProt: Q7CSU1
LinkDB All DBs
Position
linear:complement(632366..633913)
Genome map
AA seq 515 aa AA seqDB search
MSGENNIFDLFVIGGGINGCGIARDAVGRGYSVALAEKGDFASGTSSAATKLIHGGLRYL
EHYEFRLVREALMEREILWAMAPHVIWPMRFILPVQKGGVRPSWMVRLGLFLYDNLGGRK
LLPPTRTLDLRKDPAGKPLKPVFAKAFEYSDGWVDDARFVVLNARDAADRGATIMNRTRV
VSARREGRLWLIETLDEKTGRPAMHKARMLVNAAGPWVDNVLSGVFGRNDVHNVRLVQGS
HIIVRRKFSDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYKGDPAKVRISEEEISYL
CNAASDYFSEPVRPEDIVWTYSGVRPLFDDGASKAQEATRDYVLKVEQAEGEAPLLNIFG
GKLTTYRRLAEHALEKIGAAIGEKGKPWTAGSHLPGGDFGVQRFDAQVKTLLSRYPFLDE
RHAYRLVKNYGTKAANLLGAATDISGLGRHFGGTVYECEVRWLVENEWAFSAEDILWRRT
KQGLRLSKDEAAALDEFVAVLTGIREKPEAMAQRA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgaaaacaacattttcgatctttttgtcatcggtggcggcatcaatggctgc
ggcattgcccgcgatgcggtgggcagggggtattccgtggcgcttgcggaaaagggcgat
tttgcctctggcacctcgtcagcggccaccaagctcatccatggcggcttgcgttacctc
gaacattatgaattccgcctcgtacgcgaggcgctgatggaacgggaaatcctctgggcc
atggcgccgcatgtcatctggcccatgcgtttcatcctgcccgtgcagaagggcggcgtg
cgtccatcatggatggtccggctcggcctgtttctttatgacaatctcggcggccgcaag
ctcttgccgccgacgcggacgctcgatcttcgcaaggacccggctggcaaaccgctgaag
cctgttttcgccaaggctttcgaatattccgacggctgggtggatgatgcccgtttcgtg
gttctcaatgcacgcgatgcggcggatcgtggcgcgacgatcatgaaccgcacacgggtt
gtttcggcgcggcgcgaaggcaggctgtggctcatcgagacgctggacgaaaaaaccggc
cggccggccatgcacaaggcccgcatgctggtcaatgccgccggcccgtgggtggacaat
gtgctgtcaggtgtgttcggccgcaatgacgtgcacaatgtccgcctcgtgcagggtagc
cacatcatcgtgcgcaggaagttttccgatccgcgcgcctatttcttccagaatccggac
aaccgcatcatcttcgccattccctatgagcaggattttacgctgatcggcaccacggac
cgcgactataagggcgatccggccaaggtgcgcatttccgaggaggaaatctcctatctc
tgcaatgcggcgagcgactatttcagcgagccggtgcgtcccgaggatatcgtctggacc
tattccggcgtgcggccgctctttgacgatggcgcttcgaaagcgcaggaagcaacccgc
gattacgtgctgaaggtggagcaagccgaaggcgaagcgccgctcctcaatattttcggc
ggcaagctcaccacctaccggcggctggcggaacacgcgctggaaaagatcggcgcggcg
atcggcgaaaaaggcaagccatggacagcgggctcccacctgccgggcggcgatttcggc
gttcaacgatttgacgcgcaggtgaagacgcttctctcgcgttatcccttcctggacgaa
cgccatgcctaccggctcgtcaaaaactacggcacgaaagcagcgaacctgctcggcgct
gccaccgatatttccggcctcggccggcatttcggcggcaccgtctacgaatgtgaagtg
cgctggctggtggagaatgaatgggccttttcggccgaggatattctctggcgccgcacg
aaacagggcctgcgtttgagcaaggacgaagctgccgctctcgacgaattcgtggctgtg
ctgacaggtatcagggaaaagccggaagccatggcgcagagggcctga

DBGET integrated database retrieval system