KEGG   Agrobacterium fabrum: Atu3904Help
Entry
Atu3904           CDS       T00070                                 

Gene name
nrtB
Definition
(RefSeq) nitrate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
atu  Agrobacterium fabrum
Pathway
atu00910  Nitrogen metabolism
atu02010  ABC transporters
Module
atu_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Atu3904 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Atu3904 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atu02000]
    Atu3904 (nrtB)
Transporters [BR:atu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Atu3904 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 1135778
NCBI-ProteinID: NP_356730
UniProt: Q7CTL0
LinkDB All DBs
Position
linear:complement(1002720..1003613)
Genome map
AA seq 297 aa AA seqDB search
MSALARKFNEEPQQPAVQKANVVALSPKHLPRIDLRKWGAAAARNTIPPLVVLAVLLGVW
QLLCSAPGSSLPPPSQVFEESYDLIVSPFFHNGSQDIGLGLRVLVSLERVAYGFGLAAIA
GIILGAVIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAKVLRLNQLEFFFKIMLPSAAPYIFTGLRIGIGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVVGFMLDKLVAALGKVITRGAAAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcattggcccgaaaattcaacgaagagccgcagcagccggcggtgcagaaggca
aacgtcgtagcactttcgcccaaacatctgccgcggatcgatctgcgcaaatggggtgct
gcggcggcccgcaacaccataccgccgcttgtcgtccttgccgtcctgctcggcgtctgg
cagctgctctgttccgcccccggctcatcgctgccgccgccgagccaggtttttgaggaa
agctacgatcttatcgtatcgccgtttttccataatggttcgcaggatatcggccttggc
ctgcgtgtgctggtctcgctcgaacgggtggcttacggtttcggtcttgccgctatcgcg
ggtatcatccttggtgctgtgatcggccaatcggtctgggcgatgcgcggtctcgacccg
atctttcaggtgctgcgcacggtgccgccgctggcttggctgccgctgtcgctggccgcg
tttcaggacagcaatccgtcggccattttcgtgatcttcatcacctccatctggccggtc
atcatcaacacggcggtcggcgtgcgcaacatcccgcaggattatcgcaatgtcgcgaag
gtgctgcggctgaaccagctcgaattcttcttcaagatcatgctgccatcggcagcgccc
tatatcttcaccggcctgcgtatcggcatcggcctctcctggctcgccattgtggccgcg
gaaatgctgactggcggcgtcgggatcggcttcttcatctgggatgcgtggaattcctcg
cgcctgcccgacatcatcgtagcgctcgcttacatcggcgttgtcggcttcatgctcgac
aagctggtagcggcgctcggcaaggtcatcacccgcggcgctgcggccaactaa

DBGET integrated database retrieval system