KEGG   Agrobacterium fabrum: Atu4833Help
Entry
Atu4833           CDS       T00070                                 

Gene name
cga
Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
atu  Agrobacterium fabrum
Pathway
atu00500  Starch and sucrose metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Atu4833 (cga)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Atu4833 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM53
Motif
Other DBs
NCBI-GeneID: 1136707
NCBI-ProteinID: NP_355831
UniProt: Q7CVZ6
LinkDB All DBs
Position
linear:2012401..2014803
Genome map
AA seq 800 aa AA seqDB search
MRAALDFAPGAPGIDARWTSSAKNGVGTALSNTSPIWFTLSHGILNEVYYPRIDSACIRD
LGLVVTRDDGYFSEEKRDCTSLTQPFESGIPAFHVTNTATDGAYRIEKQVITDPARACVL
LHVSFSPLKGKMGDYRVSVLLAPHLVNAGNLNSAWIGDYEGRRVLFAVGRSRYLALVCDG
PWRAASAGFVGVSDGWQQLRRHGRLIEEFQRADDGNVSLAAEIDFSDAHDTATLALGFGQ
TEYEAASCAVASLKSGFRRAHDAYIANWRGWQDSLCPLDRDTHHGVNSYRVSTAVLAAHR
AADRPGAVVASLSIPWGASKGDDDLGGYHLIWPRDLVEAAGGFLAAGDHDEALAILDYLR
QVQQPSGRWPQNLWLDGKPYWPGVQMDECAFPILLADMLHRHGHLDHAARADYMPMIRSA
AAYILANGPTTGEDRWEEDAGYSPFTLAVEIAALLAAADLLDMEGDAAEATHLRQTADCW
NEQIERWTFAGDQTMCAQLGISGHYVRIASPGTTDAVQLSGMTPILNQTPDRAFLPTSDV
ISPDALALVRFGLRAPDDPHILATVKAIDHCLRAELPQGPVWYRYTGDGYGEHADGTAFD
GTGQGRPWPLLTGERAHYELAAGRRGAAEALLTTMEKSAGQSGLFPEQVWDQPDLPDREL
FYGSPSGSAMPLVWAHAEHIKLLRSLADGSVFDMPPQGVERYIRNKTPSHLRIWCFNNTI
SAMPTGKVLRLELADNAIVHWSADSWATSTDTNTTASGLGTHFADLPVQELAAGGTVVFT
FYWRDAGVWENEDFTVRLGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgcacttgatttcgcacccggcgcacccggcattgacgcacgctggacgtcg
agcgccaagaatggcgtgggaaccgcgctgtcgaacacctcaccaatctggttcacgctc
agccacggcatcctcaacgaggtctattacccgaggatcgatagtgcctgcatccgcgat
ctcggtcttgtggtcaccagagatgacggatacttttcagaagagaaacgggactgcacc
tcccttacccaacctttcgagagtggaattcccgcgttccacgtcaccaatacggcgaca
gatggagcctatcggattgaaaaacaggtcatcaccgatccggcgcgggcctgtgttctt
ctgcatgtgtccttctcgcccttgaagggaaagatgggggattaccgtgtaagcgttctt
ctggcgccgcatctagtcaatgccggtaatctcaactccgcctggataggggattatgaa
gggcgtcgggtcttgtttgcggtcggccgctcacgatatctcgctctggtctgcgacggt
ccctggcgcgccgcaagtgcgggatttgttggcgtctccgatggctggcaacaattgcgc
cggcacggacgcctcattgaggaattccagcgggcggatgacggcaatgtttcgctggct
gcggaaatcgattttagcgatgcccatgacaccgcgacgttggcgctcggtttcggccag
accgaatatgaagctgcatcctgtgctgtcgcaagtctgaagtccggcttcagacgcgca
cacgatgcctatatcgccaactggcgtggctggcaggacagtctttgccccctcgaccgc
gatacccatcacggcgtcaattcctatcgcgtctcgaccgccgtgcttgccgcgcatcgt
gccgctgaccggcctggagccgtcgtggcgagcctgtcgatcccgtggggagcctccaag
ggcgatgacgatcttggcggatatcatttgatatggccgcgggatctggtggaagccgcc
ggcgggtttctagcggccggtgatcacgatgaggctttggccatccttgattatctgcgc
caggtgcagcaaccctcggggcggtggccgcaaaatctctggctggatggcaagccctat
tggccgggcgttcagatggacgaatgcgcctttccgatcctgcttgcggatatgctgcat
cggcacggccacctcgaccacgccgcaagggcggattacatgccaatgatccgcagcgct
gcggcttatattctggcaaacggcccgacgaccggcgaggacaggtgggaggaagatgca
ggctacagcccgtttacgcttgccgtcgagatcgccgcgctgcttgccgctgctgatctg
ttggatatggagggcgatgcggccgaagccacgcatctgcggcagacagccgattgctgg
aatgagcagatcgaaaggtggacgtttgccggtgaccagaccatgtgcgcgcagcttggt
atttcgggccattatgttcgcatcgcttctcccggtaccaccgatgccgttcagctctcg
ggcatgacgcctatactcaaccagacaccggatcgcgctttcctgccaacaagcgatgtc
atcagccctgatgcacttgcgctggtccgcttcggcctgcgcgcaccggacgatccccac
attctcgcaaccgtcaaggcgatcgatcattgcctgcgcgccgagctgccgcaggggccg
gtctggtacaggtacacgggcgacgggtatggtgagcacgctgatggaacagcatttgac
ggcacgggtcagggcaggccatggccccttctgaccggcgagcgcgcccattacgaactt
gctgcgggcagacgcggggcggcggaagctttgctgaccacaatggaaaaatcggcgggg
cagagcggccttttccccgagcaggtctgggatcaacccgatcttcccgacagggagctg
ttttatggctccccgtcgggcagcgcgatgccgctggtctgggcgcatgcagaacatatc
aagcttctgcgttcgcttgccgatggctccgttttcgacatgccgccgcagggtgtggag
cgctacatccgcaacaagacaccgtcgcatcttcgaatctggtgcttcaacaacacgata
tcagccatgcccaccggcaaggttctgcggcttgaactggcggataatgccatcgtgcac
tggagcgccgacagctgggcgacgagcacagatacaaatacgacggcctccggtctcggc
acgcattttgcggacttgcccgtgcaggaactggcggccggcggcacggtagttttcacc
ttctactggcgagatgctggagtgtgggaaaacgaggactttaccgttcgcctgggcgaa
tga

DBGET integrated database retrieval system