KEGG   Agrobacterium fabrum: Atu5055Help
Entry
Atu5055           CDS       T00070                                 

Gene name
ligD
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
atu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Atu5055 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:atu03400]
    Atu5055 (ligD)
Enzymes [BR:atu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Atu5055 (ligD)
DNA repair and recombination proteins [BR:atu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Atu5055 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-GeneID: 1136828
NCBI-ProteinID: NP_395989
UniProt: Q7D410
LinkDB All DBs
Position
At:complement(52456..55110)
Genome map
AA seq 884 aa AA seqDB search
MASDKLSTYKQKRDFQKTQEPSGAAKLKASNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGNKTPE
QALAKGDFKFTLEGERLHGSFVLVRMRNDRDGGKRTNWLLIKHRDDFSVEEKGAAVLDEN
DTSVASGRTMEAIAAGKGRKPKPFMVQSGDVQADAVWDSNHGLAAEERASDTKAKRKPAL
KKPAKSTMPEFIPPQLCETLDRPPSAKGWIHEIKFDGYRIQTRIENGEVTLKTRKGLDWT
AKYPAIATSAANLPDAIIDGEICALDENGAPDFAALQAALSEGKTDELVYFAFDLLFEEN
EDLRQLPLTERKERLQTLLDDAGEDPRLRFVEHFETGGDAVLKSACKLSLEGIVSKQADA
PYQSGRTETWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGVFKGDHFVYVGRVGTGYGAKT
VDTILPRLRELETSKSPFTGIGAPKKDPNVVWVKPELVAEIQFAGWTADGLVRQAAFKGL
REDKPAHEVEAEKPASPAKTDTPTPAKSKPSRPARGKNAKAEVMGVMISSPDKALWPDAN
DGEPVTKEDLARYHEAVGPWLIDHIKGRPCSIIRTPDGIGGEVFFQRHAMPGTSNLIELV
KVFGDKKPYLQIDRVEGLAAIAQIGGVELHPWNCEPGQPEVPGRLVFDLDPGPDVPFSTV
VEAAREMRDRLEELGLVSFCKTTGGKGLHVVTPLAVPKGKKLSWPEAKGFAHDVCMQMAR
ETPELYLIKMAKNQRNGRIFLDYLRNDRMATAVAPLSPRARAGAPVSMPLSWKQVKTDLD
PKRFTIRTVPALLSKTTAWQDYCDGQRSLEQAIKRLAKSMKQAA
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacaagctctcgacctacaagcagaaacgcgattttcaaaaaacgcaggag
cctagcggcgcagcgaagctgaaggcgtcgaaccggaggcgctttgttatccagaagcac
gatgcgacccgactgcattacgacctgcgcctcgaactcgacggcgtgttcaaatcctgg
gctgtaaccaaggggccctctctcgatccgcacgacaagcgcctggctgtcgaggtcgaa
gaccatccgttggactatggcgacttcgaaggcacgatccccaaggggcagtatggcggc
ggcacggtcatgctgtgggatcgcgggtactgggagccggaaggcaacaagacgcccgaa
caggcgctcgccaaaggggatttcaagttcacgctggagggagagcggctgcatggcagc
ttcgttctggtgcggatgcgcaatgaccgcgacgggggtaagcggacgaattggctgctg
atcaaacatcgcgacgacttctctgttgaagaaaagggcgccgctgtcctcgacgaaaac
gacacgtcggtggcctcgggccgaactatggaggcgatcgccgctggcaagggcaggaag
ccaaaaccgttcatggtgcagagcggcgacgtccaggcggatgccgtttgggacagcaat
catggactagcggcggaggaacgtgcctcggacacgaaagcaaagcgaaagccagcattg
aaaaaaccagcgaagtcgacaatgccggagttcataccgccgcagctttgcgaaacgctc
gatcgcccgccttcagccaagggctggatccacgagatcaagttcgacggctaccgcatc
cagacccgcatcgaaaacggtgaggtgacgcttaaaacccgcaagggcctggactggacg
gccaagtatccggcgattgcgacatcggccgcaaacttacctgatgccattatcgacggg
gagatttgcgcgctcgatgaaaacggtgcgccggacttcgcagcacttcaggccgcactg
tcggaaggcaagaccgacgaactggtctatttcgccttcgatctgctgttcgaggagaac
gaggatctacgacaactgccgttgaccgaacgcaaggaacgcctgcagacactgcttgat
gatgccggcgaggacccacgcctgcgtttcgtcgaacatttcgaaaccggtggcgacgcc
gtcctgaagtcggcctgcaagctctcgctggaaggcattgtttcgaagcaggcggatgca
ccctatcaatccggccgcaccgagacctgggccaaatccaaatgccgcgccggccacgaa
gtggtcatcggcgcctatgccaagaccaacggcaagttccgctcgctgctggtgggagtc
ttcaagggtgatcacttcgtctatgtcggccgcgtcggaactggctacggggccaaaacg
gtcgacacgatcttgccgaggctccgggaactggaaacctcaaagtcgccctttaccggg
attggcgccccaaagaaggatcccaacgtggtctgggtcaaacccgaactggtcgcggag
atccagttcgccggctggactgcggatggcctcgtccgccaggcggcgttcaagggattg
cgcgaggacaagcctgcacacgaagtcgaggcagaaaagccggcatcgccggcaaagact
gataccccgacgccggccaagtcaaagccatcaaggccggcacgcggcaaaaacgccaag
gccgaggtgatgggcgtgatgatttccagcccggacaaagcgctctggcccgatgccaat
gacggagagccggtgaccaaggaagatcttgcgcgctatcatgaggccgtcggtccatgg
ctgatcgaccatatcaagggacggccatgctcaatcatccggacgcccgacggcatcggt
ggagaggtgttcttccagagacacgcgatgccgggaacgtcgaacctgatcgagctggtc
aaggtgttcggcgacaagaaaccctatctgcagattgatcgcgttgagggccttgccgcc
attgcccagatcggcggcgtcgaactgcacccgtggaattgcgagccgggtcaaccggag
gtgccgggccgtcttgtcttcgaccttgatccgggtccggacgtccccttctcaaccgtg
gtggaagccgctcgggagatgcgcgaccggctggaggaacttggcctcgtcagcttctgc
aaaaccaccggaggcaagggccttcacgtcgtaacgccgcttgcggtaccgaagggaaag
aagctgagctggccggaggcgaaaggcttcgcacacgatgtctgcatgcagatggcacgc
gagaccccggagctttatttgatcaagatggccaagaaccagcgcaacggtcggatcttc
ctcgactacctgcgcaatgaccgaatggcgactgctgttgcgccgctgtcaccgcgcgcg
cgggcaggcgcaccagtatcgatgccactgagctggaagcaggtaaaaacggatctcgat
ccgaaacgcttcaccattcgcaccgtaccggcgctgttgtcgaagacgaccgcctggcag
gattactgcgacgggcagcgttcgctggagcaggccatcaaacgattggcgaagtcgatg
aaacaggctgcctaa

DBGET integrated database retrieval system