KEGG   Azoarcus sp. SY39: C0099_00145Help
Entry
C0099_00145       CDS       T05265                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
atw  Azoarcus sp. SY39
Brite
KEGG Orthology (KO) [BR:atw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C0099_00145
Enzymes [BR:atw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C0099_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 DAO HI0933_like FAD_binding_3 AlaDh_PNT_C Thi4 Glutaredoxin K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AUN93481
UniProt: A0A2I6S2I2
LinkDB All DBs
Position
30889..32484
Genome map
AA seq 531 aa AA seqDB search
MLDANMKAQLKTLLERIDQDVELVAFVDDGAKSRETLELIEEIAELSAHVVARRADSVDG
ERVPSFSVSRAGTDMGVRFAGLPMGHEFTSLVLALLQAGGYPPKVGAEQIEAIRALDTEM
EFVTYISLSCHNCPDVVQALNLMAILNPKIRHSMVDGGVFRDEVESKNIMAVPTVMLNGE
EFGSGRMPLDEILAKVDTGAAAREAEKLSARDAFDVLIVGGGPAGAAAAIYAARKGIATG
IVSERFGGQVMDTMAIENFISVKETEGPKMVAALEEHVKTYEVDVMNLQRAEKLVPASSP
GGLAEVVLDNGAVLKSRTVIVATGARWKELGVTGEREYRGKGVAYCPHCDGPLFKGKHVA
VIGGGNSGVEAAIDLAGIVGHVTLIEYDARLRADAVLQAKLTSLPNVTVITSGQTTEITG
EGGRVNGLVYTDRVSGESRRVELAGVFVQIGLLPNTDFLKGTVELSRYGEVVVDARCETS
VPGIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDHLIRSTPETEKAAPVAT
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacatgaaagcccagctcaagacgcttctcgagcgcatcgatcaggat
gtggaactcgtcgccttcgtcgacgacggcgccaagtcgcgcgagacgctcgaactgatc
gaggagatcgccgaactgtccgcacacgtcgtcgcccgacgtgccgacagcgtggacggc
gagcgcgtgccctcgttctcggtgagccgtgccggcaccgacatgggcgtgcgcttcgcc
ggcctgccgatgggccacgaattcacctcgctggtgctcgcgctgctgcaggccggcggc
tacccgcccaaggtcggcgccgagcagatcgaggcgatccgcgcgctcgacaccgagatg
gaattcgtcacctacatctcgctgtcgtgccacaactgcccggacgtggtgcaggccctc
aacctgatggcgatcctcaacccgaagatccgccactccatggtcgacggcggcgtgttc
cgcgacgaggtcgagtcgaagaacatcatggcggtgccgacggtgatgctcaacggcgag
gaattcggttccgggcgcatgccgctcgacgagatcctggccaaggtcgacaccggcgcg
gccgcgcgcgaagccgagaagctctccgcccgggacgccttcgacgtgctcatcgtcggc
ggtggtccggccggtgcggccgcagccatctacgcggcgcgcaagggcatcgctaccggc
atcgtctccgagcgtttcggtggccaggtgatggacaccatggcgatcgagaacttcatc
tcggtcaaggaaaccgaaggtccgaagatggtcgccgcgctcgaagagcacgtgaagacc
tacgaggtcgacgtgatgaacctgcagcgcgccgagaagctcgtgccggcgtccagtccc
ggtggcctggccgaagtcgtgctcgacaacggcgcggtgctcaagagccgcactgtgatc
gtcgccaccggcgcacgctggaaggaactgggcgtgaccggcgagcgcgagtatcgcggc
aagggtgtggcctattgcccgcactgcgacgggccgctgttcaagggcaagcacgtggcc
gtgatcggcggcggcaactcgggcgttgaggcggccatcgatctggccggcatcgtcggt
cacgtcacgctcatcgagtacgacgccaggctgcgcgccgacgcggtgctgcaggccaag
ctcacgagtctgcccaacgtcaccgtgatcaccagcggccagaccacagagatcaccggc
gagggcggacgcgtgaatggcctggtgtataccgaccgtgtcagcggcgaatccagacgt
gtcgaactcgccggcgtgttcgtgcagatcggcctgctgcccaacaccgacttcctcaag
gggacggtggagctctcgcgctatggcgaagtcgtggtcgacgcgcgttgcgagacctcg
gtgcccggcatcttcgccgcgggcgactgcaccacggtgccgtacaagcagatcgtcatc
gccatgggcgagggcagcaaggccgcgctgtcggccttcgaccacctgatccgcagcacg
ccggaaacggaaaaggccgcgccggtcgccacctga

DBGET integrated database retrieval system