KEGG   Azoarcus sp. SY39: C0099_01195Help
Entry
C0099_01195       CDS       T05265                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
atw  Azoarcus sp. SY39
Pathway
atw03030  DNA replication
atw03410  Base excision repair
atw03420  Nucleotide excision repair
atw03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:atw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C0099_01195
   03410 Base excision repair
    C0099_01195
   03420 Nucleotide excision repair
    C0099_01195
   03430 Mismatch repair
    C0099_01195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:atw03032]
    C0099_01195
   03400 DNA repair and recombination proteins [BR:atw03400]
    C0099_01195
Enzymes [BR:atw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C0099_01195
    6.5.1.6  DNA ligase (ATP or NAD+)
     C0099_01195
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     C0099_01195
DNA replication proteins [BR:atw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    C0099_01195
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     C0099_01195
DNA repair and recombination proteins [BR:atw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     C0099_01195
   NER (nucleotide excision repair)
    Other NER factors
     C0099_01195
   MMR (mismatch exicision repair)
    Other MMR factors
     C0099_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AUN93670
UniProt: A0A2I6S328
LinkDB All DBs
Position
complement(239076..239927)
Genome map
AA seq 283 aa AA seqDB search
MKPRRLLRAAVLVWLAITTATALADASLQPMLAGRYHDGIDPSHYWVSEKYDGVRARWDG
HALTLRGGGTIAAPDWFTAALPPEETLDGELWLGRRTFDRLSGLVRRHAPEDPAWRDVRY
MVFDLPGTPGTFTTRVGRMRQIAATANVPWLQAAPQRRVANRDELQQWFDEVVIAGGEGL
MLHHAEAHWTPGRNSALLKRTPQLDDEARVIAHLPGKGRLQGMTGSLLVETPDGRRFRLG
SGLTDAQRRDPPAVGRLVTYRYRELTPNGMPRFPVFLRVRDLP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccgacgtctgttgcgcgcggccgtgctcgtctggcttgccatcacgaccgca
accgccctggcggacgccagcctccagccgatgctcgccgggcgctatcacgacggcatc
gacccttctcactactgggtcagcgaaaagtacgacggcgtacgcgcccgctgggacggc
cacgcgctcacgttgcgcggcgggggcaccattgccgcgcccgactggttcaccgccgcc
ctgccgcctgaagaaacgctggacggcgaactgtggctgggccggcggaccttcgatcgc
ctctccggcctggtgcgtcgccacgcacctgaagaccccgcctggcgcgacgtgcgctac
atggtcttcgacctgcccggcacccccggcaccttcaccacccgcgtcggacgcatgcgc
cagatcgccgccaccgccaacgtcccgtggctgcaagccgccccgcaacgccgcgtcgcc
aaccgcgacgagttgcagcaatggttcgatgaagtcgtaatcgctggcggcgaaggcctg
atgctccaccacgccgaagcccactggacccccggccgcaactccgccctgctcaaacgc
accccccagctcgacgacgaagcccgggtcatcgcccacctgcccggcaaagggcgcctg
caaggcatgaccggctccctgctcgtcgaaacccccgacggccgccgcttccgcctcggc
agcggcctcaccgacgcccagcgccgcgacccgccagcggtggggcgtctggtgacctat
cgctatcgggaactcacaccaaacggaatgccgcggtttccggtgtttctgcgggtgcgg
gacttgccgtga

DBGET integrated database retrieval system