KEGG   Azoarcus sp. SY39: C0099_04210Help
Entry
C0099_04210       CDS       T05265                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
atw  Azoarcus sp. SY39
Pathway
atw00030  Pentose phosphate pathway
atw00710  Carbon fixation in photosynthetic organisms
atw01100  Metabolic pathways
atw01110  Biosynthesis of secondary metabolites
atw01120  Microbial metabolism in diverse environments
atw01130  Biosynthesis of antibiotics
atw01200  Carbon metabolism
atw01230  Biosynthesis of amino acids
Module
atw_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:atw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C0099_04210 (tkt)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    C0099_04210 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    C0099_04210 (tkt)
Enzymes [BR:atw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     C0099_04210 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AUN94214
UniProt: A0A2I6S4M7
LinkDB All DBs
Position
complement(881896..883914)
Genome map
AA seq 672 aa AA seqDB search
MSSERNVKPPVFNPVTGAIRALAMDAVQKAKSGHPGAPMGMAEIAEVVWRRHLRHNPANP
QWADRDRFVLSNGHGSMLLYALLHLTGYDLPIEELKNFRQLHSKTPGHPEYGYAPGVETT
TGPLGQGLANAVGMAIAEKLLADEFNRPGHDIVDHRSFVFLGDGCLMEGISHEACSLAGT
LGLGKLVAFYDDNAISIDGDVEGWFTDDTPRRFEAYGWQVIRDVQGHDSDAVDAAVHEAL
ADATRPTLICCKTVIGAGAPNKQGGHDVHGAPLGDAEIAAVREHIGWDHPPFEIPTEIYA
AWDATAAGAAREAQWNAQFEAYRAEHPALAAEFERRIAGRLPEDWNAHVASTLQAIVAKA
ETIATRKASQNAIEAFAPKLPELLGGSADLAGSNLTLWSGARGVTKDTGGNYIYYGVREF
GMSAIANGISLHGGLIPYTATFLMFSEYARNALRMAALMKLRQVFVYTHDSIGLGEDGPT
HQPVEQAATLRLIPNMDVWRPCDTVESAVAWAHAIERADGPSALLFSRQNLPFQTRSEAQ
VADIRRGGYVLSEAAGGAPRAVIIATGSEVALAMAAQKQLADAGMPVRVVSMPSTNVFDR
QDAAWQTAVLPAGVPRVAVEAGVTDGWYKYVGLDGAVVGLDRFGESAPAGDLFKYFGFTA
EAVVEAVRRVTA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgagcgcaacgtcaagccgcccgtgttcaacccggtgaccggagcgatccgc
gccctcgcgatggatgcggtgcagaaagccaagtccggccacccgggcgcgcccatgggc
atggccgagatcgccgaagtcgtgtggcgtcgccatctgcgacacaacccggccaacccg
cagtgggccgaccgcgaccgtttcgtgctctccaacggccacggctcgatgctcctgtac
gcactgctgcacctgaccggctacgacctgccgatcgaagagctgaagaacttccgccag
ctccacagcaagacccccggccaccccgaatacggctacgcaccgggcgtggagaccacc
accggcccgctcggccagggcctggccaacgcggtcggcatggccatcgcggagaagctg
ctggctgacgagttcaaccgccccggccacgacatcgtcgaccaccgcagcttcgtcttt
ctcggcgacggctgcctgatggaaggcatctcgcacgaggcctgctcgctggccggcacg
ctgggcctgggcaagctggtggccttctacgacgacaacgccatttccatcgacggtgac
gtcgaaggctggttcaccgatgacacgccgcgccgtttcgaagcctacggatggcaggtc
atccgcgacgtgcagggccacgactccgacgccgtcgacgcggccgtgcacgaggcgctg
gccgatgccacgcgccccacgctgatctgctgcaagacggtgatcggcgccggcgccccc
aacaagcagggcggccacgacgtgcacggcgcgccgctgggcgacgccgaaatcgctgca
gttcgcgagcacatcggctgggaccacccgccgttcgagatcccgaccgagatctacgcc
gcctgggacgcgaccgccgccggcgcggcgcgcgaggcgcagtggaacgcgcagttcgag
gcctatcgcgccgaacatccggcgctggccgcagagttcgagcgacgcatcgccggccgt
ctgcccgaggactggaacgcgcacgtcgccagcacgctgcaggcgatcgtcgccaaggcc
gagaccatcgccacgcgcaaggccagccagaacgcgatcgaggccttcgcgcccaagctg
cccgaactgctcggcggctcggcggatctggccggctccaacctcacgctgtggtcgggc
gcgcgcggcgtcaccaaggacaccggcggcaactacatctactacggcgtgcgcgagttc
ggcatgtcggccatcgccaacggcatcagtctgcacggcggcctgattccctacaccgcc
accttcctgatgttcagcgagtacgcgcgcaacgcgctgcgcatggctgcgctgatgaag
ctgcgtcaggtcttcgtctacacgcatgactccatcgggctgggcgaggacggccccacc
caccaaccggtcgagcaggctgccacgctgcgcctgattcccaacatggacgtgtggcgt
ccgtgcgacacggtggaatctgccgtggcctgggcgcatgccatcgagcgtgccgacggt
ccgtccgcgctgctgttctcgcgccagaacctgcccttccagacgcgcagcgaggcgcag
gtcgccgatattcgccgtggtggctacgtactgtccgaggccgcaggtggtgcgccgcgt
gcggtgatcatcgccaccggttcggaagtcgcgctggccatggccgcgcagaagcagctg
gcggacgccggcatgccggtgcgcgtggtgtcgatgccctcgaccaacgtcttcgaccgc
caggacgcggcatggcagaccgccgtgttgccggccggcgtgccgcgcgtcgcggtcgag
gccggcgtcaccgacggttggtacaagtatgtcgggctcgacggcgcggtggtcgggctg
gatcgcttcggcgaatcggcgccggccggcgacctgttcaagtacttcggcttcaccgcc
gaggccgtcgtcgaggccgtccgacgcgtcaccgcctga

DBGET integrated database retrieval system