KEGG   Azoarcus sp. SY39: C0099_07280Help
Entry
C0099_07280       CDS       T05265                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
atw  Azoarcus sp. SY39
Brite
KEGG Orthology (KO) [BR:atw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:atw01001]
    C0099_07280
Enzymes [BR:atw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C0099_07280
Protein kinases [BR:atw01001]
 Serine/threonine kinases: Other
  Bacterial family
   C0099_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding APH Kinase-like Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AUN94752
UniProt: A0A2I6S665
LinkDB All DBs
Position
1513255..1514616
Genome map
AA seq 453 aa AA seqDB search
MSELPSRIGRFEILEKVGQGATATVYRAVSPDHPEGVAIKHVRFGQGDGEARRVRRLKKL
LKAEAAVARRLEHPNIIRIDEVVFEDDAAHVVMEYFPGLPLARHCRFDNLLPLHRVMGIV
FKCCMALDHAFRQGVVHRDIKPDNILVDAEDNVKITDFGLALNLDRKQQSDSTFIVGVGS
PAYMSPEQIKSYPLNQKTDLYSLGVVLFHLLTGRLPFRANNHAQLIYKILNADPPSPSRL
NPDLPQGVDAVVAKALEKDLYSRYRNGAQFAQDLSAIRYKIVDESQRPSDTRRFEVLRRL
AFFTEFDDVELWEALRISAWRRVDAGVAVFRENDEDPRFALLIDGEVEISIDGRRVERLG
PGSAFGELAWLDVGTSRQMTTAVTVVESIYLEVSPSALALASEEVRDKFRAVVGAIAARR
CAEAMRAIAAGGEQALPARRAAPGRLDLQLVDD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcttccttcccgtatcggcaggttcgagatcctcgaaaaggtcgggcagggc
gcgaccgccacggtctatcgggcggtgagccccgatcacccagagggggtggcgatcaag
catgtgcgcttcggacagggcgacggcgaagcgcgccgcgtgcgccgcctgaagaagctg
ctcaaggccgaggccgcggtggcccggcgcctggagcatcccaacatcatacgcatcgac
gaagtcgttttcgaggacgatgcggcgcatgtggtgatggagtatttccccggcctgccg
ctggcgcgccactgccgcttcgacaatctgttgccgttgcatcgcgtgatgggcatcgtt
ttcaagtgctgcatggcgctcgaccacgccttccggcaaggagtggttcatcgcgacatc
aagcccgacaacatcctcgtcgacgccgaagacaacgtgaagatcaccgacttcggcctg
gcgctcaatctggatcgcaagcagcagtcggattcgaccttcatcgttggcgtgggctcg
cccgcctacatgagcccggagcagatcaagagctacccgctgaatcagaagaccgacctg
tattcgctcggggtcgtgctcttccacctgctcaccggccgcttgccgtttcgcgcgaac
aaccacgcgcagctgatctacaagatcctcaacgccgatccgccgtcgccttcgcgcctc
aacccggacctgccccaaggggtcgatgcggtggtcgcgaaggcgctcgagaaggatttg
tactcgcgctaccgcaacggcgcgcagttcgcccaggatctgtcggcgattcgctacaag
atcgtcgacgagagccagcgcccctcggacacgcgacgcttcgaagtgctgcgccggctg
gccttcttcaccgaattcgacgacgtcgagctgtgggaggctttgcgcatttcggcgtgg
aggcgtgtcgacgccggcgtggcggtattccgcgagaacgatgaagacccgcgcttcgca
ttgctcatcgacggcgaggtggagatctccatcgatggtcgccgcgtcgagcgcctcggc
ccggggtcggccttcggcgagctggcctggctggatgtgggtacttcgcgtcagatgacg
accgccgtgacggtggtcgagtcgatctacctcgaggtgagtccgtcggcgttggcactc
gcctcggaggaagtgcgcgacaagtttcgcgcagtcgtcggagcgattgccgcgcgccgc
tgcgccgaggccatgcgcgccatcgccgcgggtggcgagcaggccctgccggcgcgtcgg
gctgcacccgggcggctcgatctgcagctggtcgacgactga

DBGET integrated database retrieval system