KEGG   Azoarcus sp. SY39: C0099_11250Help
Entry
C0099_11250       CDS       T05265                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
atw  Azoarcus sp. SY39
Pathway
atw00020  Citrate cycle (TCA cycle)
atw00480  Glutathione metabolism
atw01100  Metabolic pathways
atw01110  Biosynthesis of secondary metabolites
atw01120  Microbial metabolism in diverse environments
atw01130  Biosynthesis of antibiotics
atw01200  Carbon metabolism
atw01210  2-Oxocarboxylic acid metabolism
atw01230  Biosynthesis of amino acids
Module
atw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:atw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0099_11250
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C0099_11250
Enzymes [BR:atw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C0099_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AUN95452
UniProt: A0A2I6S884
LinkDB All DBs
Position
complement(2301919..2304162)
Genome map
AA seq 747 aa AA seqDB search
MSQQPTIFYTITDEAPMLATTAFLPVVRTFTAPAGIKVEEADISLGARILAEFPEFLSDE
QKVPNTLAELGALTLQPDANIIKLPNISASVGQLKAAVKELQGKGCKVPDYPEDPKSDEE
NAIKERYSKCLGSAVNPVLREGNSDRRAPLAVKNYVRKHPHSMGEWKQWSRTHVSHMHHG
DFYHGEKSMTLDRARDVKMELVTASGETLVLKPRVALQDGEVIDSMFMSKKALCEFYERE
LEDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYREAFEKHGKLFDELGVNVNNGMSD
LYEKIKSLPESLRDEIIRDLHACQEHRPELAMVDSAKGITNFHSPNDIIVDASMPAMIRQ
GGKMWGADGKPHDCKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAEE
YGSHDKTFEVPEAGVANITDLATGEVLLSQNVEAGDIWRMCQVKDAAIRDWVKLAVTRAR
NSGMPAIFWLDPYRPHENELIKKVRTYLQDHDTSGLDIQIMSQVRAMRYTLERVVRGLDT
ISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLYETGAGGSAPKHVQQLVEENH
LRWDSLGEYLALAVSLEELGIKNGNARAKILARTLDEATGKLLDLDKSPSRRTGELDNRG
SQFYLTLYWAQALAAQSEDAELAAFFAPLAKSLDEGEDRIVAELKEVQGKPVDIGGYYRV
DSAKCKAVMCPSATFNDALAALAALGA
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcagccgaccatcttctacaccatcaccgacgaagccccgatgctggcgacc
accgcctttttgccggtggtccgtacctttaccgcacccgccggcatcaaggtcgaggaa
gccgatatctcgctgggcgctcgcatcctcgccgagttccccgaattcctgagcgacgag
cagaaggtgcccaacaccctggccgaattgggcgcgctgacgctgcagccggacgcaaac
atcatcaagttgcccaacatctccgcctcggtgggccagctcaaggcggcggtgaaggag
ctgcagggcaagggctgcaaggtgccggattacccggaagacccgaagagcgacgaagaa
aatgccatcaaggagcgctattccaagtgtctgggttcggcggtgaaccctgtgctgcgc
gaaggcaactccgaccgccgcgcgccgttggcggtgaagaactacgtccgcaagcacccg
cactcgatgggtgagtggaagcagtggtcgcgcacccacgtctcccacatgcaccacggc
gacttctaccacggcgagaagtcgatgacgctcgatcgcgcacgcgacgtgaagatggaa
ctggtcaccgcctccggtgagaccctcgtgctcaagcccagggttgccttgcaggacggc
gaggtcatcgactcgatgttcatgagcaagaaggcgctgtgcgagttctacgagcgcgag
ctcgaggactgccgcgaagccggcatcctgttctcgctgcacgtaaaggcgacgatgatg
aaggtctcgcaccccatcgtcttcggtcactgcgtcaagatctactacagggaggcattc
gagaagcacggcaagctgttcgacgagctgggcgtgaacgtcaacaacggcatgagcgac
ctctacgagaagatcaagtcgctgccggaatccctgcgcgacgagatcatccgtgatctg
catgcctgccaggagcatcgcccggagctggcgatggtggattctgccaagggcatcacc
aacttccattcgcccaacgacatcatcgtcgacgcatccatgccggcgatgatccgccag
ggcggcaagatgtggggtgcggacggcaagccccacgactgcaaggcggtgatgccggaa
tcgaccttcgcccgcatctaccaggagatgatcaacttctgcaaatggcacggcaacttc
gatccgaagaccatgggtaccgtgcccaacgtcggcctgatggcgcagaaggccgaggaa
tacggctcccacgacaagaccttcgaggtgccggaggcgggtgtggccaacatcaccgat
ctggccaccggcgaagtgctgctgtcgcagaacgtggaagccggcgacatctggcgcatg
tgccaggtcaaggacgcggccatccgcgactgggtcaagctggccgtgacccgcgcgcgc
aactccggcatgccggccatcttctggctcgacccctatcgcccgcacgagaacgaactc
atcaagaaggtccggacctacctccaggatcacgacaccagcgggctggacatccagatc
atgtcgcaggtgcgcgccatgcgttacacgctggagcgcgtcgtgcgcggtctggacacc
atctcggtgaccggcaacatcctgcgcgactacctcactgacctgttccccatcatggag
ttgggcacctcggccaagatgctctccatcgtcccgctgatggccggcggcggcctgtac
gagaccggcgccggcggctcggcgcccaagcacgtgcagcaattggtggaagagaaccac
ctgcgctgggattcgctgggcgagtacctcgcgctggcggtatcgctggaagaactcggc
atcaagaacggcaatgccagggccaagatcctcgccagaacgctggacgaggccaccggc
aagctgctcgatctcgacaagtcgccctcgcgtcgcaccggcgaactggacaaccgcggc
agccagttctacctgaccctgtactgggcgcaggcgctggccgcgcagagcgaggacgcc
gagctggccgccttcttcgcgccactggcgaagtcgctcgatgagggcgaggacaggatc
gtcgccgagctcaaggaagtgcagggcaagccggtggacattggcggctactaccgcgtg
gattcagcaaagtgcaaggcggtgatgtgtccgagtgccaccttcaatgacgcactggcc
gcactggccgcgttgggcgcttga

DBGET integrated database retrieval system