KEGG   Azoarcus sp. SY39: C0099_12260Help
Entry
C0099_12260       CDS       T05265                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
atw  Azoarcus sp. SY39
Pathway
atw00473  D-Alanine metabolism
atw00550  Peptidoglycan biosynthesis
atw01100  Metabolic pathways
atw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:atw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    C0099_12260
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C0099_12260
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    C0099_12260
Enzymes [BR:atw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C0099_12260
Peptidoglycan biosynthesis and degradation proteins [BR:atw01011]
 Precursor biosynthesis
  Amino acid ligase
   C0099_12260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_Ter ATPgrasp_ST ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AUN95633
UniProt: A0A2I6S8P4
LinkDB All DBs
Position
complement(2502845..2503759)
Genome map
AA seq 304 aa AA seqDB search
MTDRFGKVAVLFGGTSAEREVSLMSGSAVLAALQGCGVDAHGFDPAERDLCALRDEGFER
VFIALHGRGGEDGTVQGVLETLRIPYTGSGVMASALAMDKWRTKMVWAACGLPTPRYAIL
DAQTDFDAVAAELGMPVFVKPAHEGSSMGATKVVEPSQLRAAWELAARYDRLVLAEAFID
GAELTVPFLNDRALPVIRIDAPGGNYDYEHKYFSDETRYLCPSGLDAALEDALKRLVMQS
AAVLGCRGWGRVDIMLDRDGRPWLLEMNTVPGMTGHSLVPMSAQAAGLGFGQLCIAILEG
ASLG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacaggttcggaaaggtcgcggtgctgttcggcggcacatcggccgaacgcgag
gtctcgctgatgtcgggcagcgccgtgctcgcggcgctgcagggttgcggcgtggatgcg
cacggcttcgatccggccgagcgcgatctgtgtgcgctgcgcgacgagggattcgagcgt
gtcttcatcgcactgcacggccgtggcggcgaagacggcacggtgcagggggtgctcgag
accctgcgcattccgtataccggcagcggcgtgatggcttcggcgctggccatggacaag
tggcgtaccaagatggtgtgggccgcctgcggcctgcccacgccgcgctatgcgattctc
gacgcgcagacggatttcgatgccgtcgccgccgaactgggcatgccggtgttcgtcaag
ccggcgcacgaaggctcgagcatgggcgcgaccaaggtcgtcgagccatcgcagttgcgt
gcagcctgggagctggccgcgcgctacgaccgcctggtactggccgaggccttcatcgac
ggcgccgagctgaccgtgcctttcctgaatgatcgcgcgctgccggtgatccgcatcgac
gcgccgggcggcaactacgactacgagcacaagtatttcagcgacgagacgcgctatctg
tgtccgtcggggctggacgccgcgctcgaggacgcactcaagcgccttgtgatgcaaagc
gcggcagtgctcggctgccgcggctggggacgcgtggacatcatgctcgaccgcgacggc
cgtccctggctgctggaaatgaacaccgtgccgggcatgaccggccactccctggtgccg
atgtcggcgcaggccgccggtctgggtttcgggcagttgtgcatcgcgatcctggaaggg
gcaagtcttggctga

DBGET integrated database retrieval system