KEGG   Aureimonas sp. AU20: M673_00060Help
Entry
M673_00060        CDS       T04161                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00061  Fatty acid biosynthesis
aua00780  Biotin metabolism
aua01100  Metabolic pathways
aua01130  Biosynthesis of antibiotics
aua01212  Fatty acid metabolism
Module
aua_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M673_00060
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M673_00060
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    M673_00060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aua01004]
    M673_00060
Enzymes [BR:aua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     M673_00060
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     M673_00060
Lipid biosynthesis proteins [BR:aua01004]
 Fatty acid synthase
  Component type
   M673_00060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Acetyltransf_1
Motif
Other DBs
NCBI-ProteinID: ALN71079
UniProt: A0A0S2EIG7
LinkDB All DBs
Position
11415..12251
Genome map
AA seq 278 aa AA seqDB search
MNDLMKGKRGLVMGVANHNSIAWGAARALASQGAEIAFSYQGEAFGKRLRPLAAEIGSTL
LVDCDVEDIASVDALFATLEKEWGKIDFVVHAIGFSDKNELKGLYADTTRENFTRTMVIS
CFSFTEIAKRAAGMMNEGGSLVTLTYGGSMRVMPNYNVMGVAKAALEASVRYLAADFGPR
DIRVNAVSAGPLRTLAGAGVSDARLMLNYQRRNAPMRRNVTHEEVGNSTLYLLSDLSKGV
TGEIHYVDAGYNIMSMPALDELKAQERRAVAAGETVSE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgatgaagggcaagcgcggcctcgtgatgggcgtcgccaaccacaattcc
atcgcctggggcgcggcacgcgcgctggcgtcgcaaggcgccgagatcgccttcagctac
cagggcgaagcgttcggaaagcgcctgcgcccactggcggccgagatcggctcgaccctc
ctcgtcgattgcgacgtggaggacatcgcgtcggtggatgcactcttcgccacgctggaa
aaggagtggggcaagatcgatttcgtcgtccacgccatcggcttttccgacaagaacgag
ttgaagggcctctacgccgacacgacgcgcgagaacttcacccgcaccatggtgatctcc
tgcttctccttcacggagatcgccaagcgcgcggccggcatgatgaacgagggcggctcg
ctggtgacgctgacctatggcggctcgatgcgcgtcatgccgaactacaacgtgatgggc
gtcgccaaggcggcgctggaggcctcggtgcgctatctcgcggccgatttcggcccgcgc
gacattcgcgtcaacgccgtttcggccggccccctgcgcacgctggcgggcgcgggcgtc
tccgacgcgcgcctgatgctgaactaccagcgccgcaatgcgccgatgcgccgcaacgtg
acgcatgaggaggtcggcaactcgacgctttatctcctgtcggacctgtccaagggcgtg
accggggagatccactatgtcgacgccggctacaacatcatgtccatgccggcgctggac
gagttgaaggcgcaggagcgccgcgccgtcgcggccggcgagaccgtctccgaataa

DBGET integrated database retrieval system