KEGG   Aureimonas sp. AU20: M673_00535Help
Entry
M673_00535        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
aua  Aureimonas sp. AU20
Pathway
aua00910  Nitrogen metabolism
aua02010  ABC transporters
Module
aua_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    M673_00535
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    M673_00535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aua02000]
    M673_00535
Transporters [BR:aua02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    M673_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: ALN71176
UniProt: A0A0S2EIQ0
LinkDB All DBs
Position
122763..123677
Genome map
AA seq 304 aa AA seqDB search
MFQTVSKLPAAKVAPSAAVAPVAAPAQIVALPRRRAPFTAAIGERLRDFAAATLPFLVTL
AVLLGLWELACSGPGAALPPPSQVLSTSWELIVHPFYVNGGTDVGLGWQIWASLQRVAMG
YAIAVVVGISLGVLVGQSTLAMRGLDPIFQVLRTVPPLAWLPLSLAAFQNGQPAAIFVIF
ITAVWPIIINTAVGIRNIPADYRNVAAVLRLNGFEFFAKIMLPAAAPYIFTGLRIGVGLS
WLAIVAAEMLIGGVGIGFFIWDAWNSSLISDIIVALAYVGVVGFVLDRIVALVGRLVTRG
TSAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttccagaccgtttccaagctcccggccgcgaaggtcgcgccctccgccgctgtcgcg
ccagttgccgccccggcccagatcgtggccttgccgcgccggcgcgcgcccttcaccgcc
gcgatcggcgagcgcctgcgggactttgccgccgcgacgctgccctttctggtgacgctg
gccgtgctgctcgggctctgggaactcgcctgctccggccccggcgcggcgctgccgccg
ccgagccaggtgctctccaccagctgggagctgatcgtccatccgttctacgtcaatggc
ggaaccgatgtcggcctcggctggcagatctgggcgagcctgcagcgcgtcgccatgggc
tatgccatcgctgtcgtggtcggcatctcgctcggcgtgctggtcggccagtcgacgctc
gccatgcgcggcctcgacccgattttccaggtgctgcgcaccgtgccgccgctcgcctgg
ctgccgctctcgctcgccgccttccagaacggccagcccgccgcgatcttcgtgatcttc
atcaccgccgtctggccgatcatcatcaacacggccgtcggcatccgcaacattccggcc
gactatcgcaacgtcgccgccgtgcttcggctgaacggcttcgagttcttcgccaagatc
atgctgccggccgccgccccctatatcttcaccgggcttcgcatcggcgtcggcctgtcc
tggctcgccatcgtggcggccgagatgctgatcggcggcgtcggcatcggcttcttcatc
tgggacgcttggaactcctcgctgatctccgacatcatcgtcgcgctcgcctatgtcggc
gtggtcggcttcgtgctcgaccggatcgtggcccttgtcggccgcctcgtcacccgcggc
acctccgccgcctga

DBGET integrated database retrieval system