KEGG   Aureimonas sp. AU20: M673_08060Help
Entry
M673_08060        CDS       T04161                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aua  Aureimonas sp. AU20
Brite
Enzymes [BR:aua01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M673_08060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALN72663
UniProt: A0A0S2EN32
LinkDB All DBs
Position
1787694..1788296
Genome map
AA seq 200 aa AA seqDB search
MAFTLPELPYAYDALQPFMSKETLEYHHDKHHQAYVDMGNKLAAEAGLADASLEEIVKQS
FGKNQPLFNNAGQHYNHIHFWKWMKPNGGGKSLPGKLQTAFDSDLGGYDKFRTDFVEAGK
GQFGSGWAWVAVKDGKLQIVKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLVNWDYVLERYEAATA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccttcacgcttcccgaactgccttacgcctatgacgcgctgcagcccttcatgtcg
aaggagacgctggagtaccatcacgacaagcaccaccaggcctatgtcgacatgggcaac
aagctcgccgccgaggcgggcctcgccgacgcctcgctcgaagagatcgtgaagcagtcc
ttcggcaagaaccagccgctcttcaacaatgccggccagcactacaaccacatccatttc
tggaagtggatgaagccgaacggcggcggcaagtccctgccgggcaagctgcagacggcc
ttcgattccgatctcggcggctacgacaagttccgcaccgacttcgtcgaagcgggcaag
ggccagttcggttcgggctgggcctgggtcgcggtgaaggacggcaagcttcagatcgtc
aagacgccgaacggcgagaacccgctggtgcacggcgcggagccgatcctcggcgtcgac
gtctgggagcattcctactacatcgactaccgcaacgcccgcccgaaatatctcgaggcc
ttcgtcgacagcctcgtgaactgggattacgtgctggagcgctacgaggccgctaccgcc
tga

DBGET integrated database retrieval system