KEGG   Aureimonas sp. AU20: M673_08300Help
Entry
M673_08300        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M673_08300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aua02000]
    M673_08300
Enzymes [BR:aua01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     M673_08300
Transporters [BR:aua02000]
 Other Transporters
  Pores ion channels [TC:1]
   M673_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALN72711
UniProt: A0A0S2EN73
LinkDB All DBs
Position
1840579..1841208
Genome map
AA seq 209 aa AA seqDB search
MAEDLIFYTNPMSRGRMVRWMLEEVGASYETRLLGYGGDMKSADYLAINPMGKVPAIVHG
EAVVTEVAAICCYLADTFPEVALVPQRGRARAAYYRWMFFAAGPLEAAVVNRALGVAVSD
EQTRMVGYGRYETVMDALEYAVSNGGDYIAGDRFSAADVYVGSHVLWGLRFGSIDKRPAF
EAYAARLTERPAYARAGQIDDALLAAAKA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacctcatcttctacaccaacccgatgtcgcgcggccgcatggtccgctgg
atgctggaggaggtcggcgcttcctatgagacgcgcctcctcggctacggcggcgacatg
aagtcggcggattatctcgccatcaacccgatgggcaaggtgcccgccatcgtgcatggc
gaggccgtggtgaccgaagtcgcggcgatctgctgctatctcgccgacacgtttcccgaa
gtcgccctcgtgccgcagcgcggtcgggcgcgcgctgcctattaccgctggatgttcttc
gccgccggcccgctggaagccgcggtcgtcaaccgcgcgctcggcgtcgcggtgtcggac
gagcagacccgcatggtcggctatggccgctacgagacggtgatggacgcgctggaatac
gccgtgtcgaatggcggcgactacatcgccggcgatcgcttctccgccgccgacgtctat
gtcggcagccacgtcctttgggggctgcgctttggctcgatcgacaagcggccggccttc
gaggcctatgccgcgcgccttaccgagcgccccgcctacgcccgcgccggccagatcgac
gacgcgcttctggcggcggccaaggcttga

DBGET integrated database retrieval system