KEGG   Aureimonas sp. AU20: M673_11265Help
Entry
M673_11265        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00010  Glycolysis / Gluconeogenesis
aua00020  Citrate cycle (TCA cycle)
aua00620  Pyruvate metabolism
aua01100  Metabolic pathways
aua01110  Biosynthesis of secondary metabolites
aua01120  Microbial metabolism in diverse environments
aua01130  Biosynthesis of antibiotics
aua01200  Carbon metabolism
Module
aua_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M673_11265
   00020 Citrate cycle (TCA cycle)
    M673_11265
   00620 Pyruvate metabolism
    M673_11265
Enzymes [BR:aua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M673_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 HlyD_2 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ALN73298
UniProt: A0A0S2EPU6
LinkDB All DBs
Position
2474598..2476025
Genome map
AA seq 475 aa AA seqDB search
MPINVTMPALSPTMEEGNLAKWLVKEGDKVSSGDVIAEIETDKATMEVEAVDEGTVAKIL
VPAGTEGVKVNAVIAILAAEGEDASAAASGGGESAKPTASAAQSVASDDAVVGKQSDAAD
AGQRGYERAAETASASEGGKGSAGSATSAGNASASGRVFASPLARRIAKEQGVDLSGVTG
SGPHGRIVKSDIERAAQEPKSAKPPEAKAAPQAATETQAAAPIAKASNDDAILKLFAEGS
YEKIPHDGMRKTIAKRLVESKQTVPHFYLSVDCELDALLALRKQLNSSAPMVKGEAGERP
AYKLSVNDMVIKAMACALKAVPEANVSWTESAMLKHKHADVGVAVSIEGGLITPIIRRAE
EKTLSVISNEMKDLAKRARSRKLKPEEYQGGTTAVSNLGMFGIKDFSAVINPPHATILAV
GAGEERAVVKSGAVAIANVMTVTLSTDHRAVDGALGAELISAFKRFIENPMSMLV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtgacgatgccggcgctctcgccgaccatggaagaaggcaatctcgcg
aagtggctggtcaaggaaggcgataaggtttcttcgggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacggtcgccaagattctc
gtccccgccgggacggaaggcgtgaaggtcaacgcggtgatcgcgattctcgccgccgaa
ggcgaggacgcctcagctgccgcttccggtggtggcgaatccgctaagcccaccgcctcc
gcggcgcagtccgtcgccagtgatgatgccgtggtcggcaagcagagcgacgcggctgat
gccggccagcgcggctatgagcgcgcggccgagaccgcctcggccagcgaaggcggcaag
ggcagcgctggctccgccacgagcgccggcaatgcgtcggcctcgggccgtgttttcgct
tcgccgctggcgcgccggattgccaaggagcagggggtcgatctttcgggcgtcacgggt
tcaggtccgcatggccgcatcgtgaagtcggatatcgagcgcgccgcgcaggaaccgaaa
tcggccaagccgccggaagccaaggccgccccgcaggcagccaccgagactcaagctgcc
gcgccgatcgccaaggcttcgaacgacgacgccattctcaagctcttcgccgaagggtcc
tacgagaagatcccgcatgacgggatgcgcaagaccatcgccaagcgcttggtcgagtcc
aagcagaccgtgccgcatttctacctctcggtagattgcgagctcgacgcgctcttggcg
ctgcgcaagcagctgaacagctcggcgccgatggtcaagggcgaggcaggcgagcgcccc
gcctacaagctttcggtcaacgacatggtcatcaaggccatggcctgcgcgctgaaggcg
gtgccggaggcgaatgtttcctggacggaaagcgctatgctgaagcacaagcacgccgat
gtcggcgtcgccgtgtcgatcgaaggcggcctgatcacgccgatcattcgccgcgccgag
gagaaaacgctctccgtcatctccaacgagatgaaggacctcgccaagcgcgcgcgcagt
cgcaagctgaagcccgaggaatatcaaggcggcacgacggccgtttcgaacctcggcatg
ttcggcatcaaggacttctcagccgtcatcaacccgccgcatgccacgatccttgcggtc
ggcgcgggcgaggagcgggctgtcgtgaagagcggtgcggtggcgatcgccaatgtcatg
accgtgacgctttcgaccgaccatcgcgcggtggacggcgcgctcggcgccgaactgatc
tcggccttcaagcggttcatcgaaaacccgatgagcatgctggtctga

DBGET integrated database retrieval system