KEGG   Aureimonas sp. AU20: M673_15290Help
Entry
M673_15290        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00473  D-Alanine metabolism
aua00550  Peptidoglycan biosynthesis
aua01100  Metabolic pathways
aua01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M673_15290
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M673_15290
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    M673_15290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aua01011]
    M673_15290
Enzymes [BR:aua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M673_15290
Peptidoglycan biosynthesis and degradation proteins [BR:aua01011]
 Precursor biosynthesis
  Amino acid ligase
   M673_15290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 Imm7 GARS_A
Motif
Other DBs
NCBI-ProteinID: ALN74090
UniProt: A0A0S2ES02
LinkDB All DBs
Position
complement(3286704..3287627)
Genome map
AA seq 307 aa AA seqDB search
MTLHVAVLLGGFSSERPVSLNSGRECADTLEAEGFRVSRIDVGHDIAQVLAELKPDVAFN
ALHGPFGEDGTIQGVLEFLEIPYTHSGVLASALAMNKVKAKTVARAAGVPVLETLVVDRR
KAATSHVIPAPYVVKPIAEGSSFGVLIVREDQAHPPQQLHGTDWAFGEEVMIERFVAGRE
LTCAVMGDVALPVCEITTEGHAFYDYESKYLPGGSKHVIPAAISPAVTKRVQEAALAAHR
AIGCRGVSRSDFRYDDRFGEGGELIWLEINTQPGMTATSLVPDIARAAGHSFGDLLSWMV
RDASCKR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcatgtggcggtgctgttgggtggcttctcgtcggaaaggccggtgagcctc
aattccggccgggagtgcgccgacacgttggaggccgagggcttccgcgtcagccgcatc
gatgtcggccacgacatcgcccaggtcctggccgagctgaagcccgatgtcgccttcaac
gcgctgcacgggccgttcggcgaggacggcacgatccagggcgtgctcgaatttctggaa
attccctacacgcattcgggcgtgctcgcctcggcgctcgccatgaacaaggtgaaggcc
aagaccgtcgcccgcgcggccggcgttcccgtgctcgaaaccctggtggtggaccgccgc
aaggcggcgacgagccacgttatccccgcgccctacgtcgtgaagccgatcgcggaaggc
tcctccttcggcgtcctgatcgtgcgcgaggatcaggcccacccgccgcagcagcttcac
ggcacggactgggccttcggcgaagaggtgatgatcgagcgtttcgtggccggccgcgag
ctgacctgcgccgtcatgggcgacgtggcgctgccggtctgcgagatcacgaccgagggc
cacgccttctacgactacgagtccaagtatctgccgggcggctccaagcacgtcattccc
gcagcgatttccccggcagtgaccaagcgtgtgcaggaagcggcgctggccgcccaccgc
gccatcggctgccgcggcgtgtcgcgctcggacttccgctacgacgaccgcttcggcgaa
ggcggcgagctgatctggctggagatcaacacccagccgggcatgaccgcgacctcgctc
gtgcccgacatcgcccgcgcggccggccattccttcggtgatctcctgagctggatggtg
agggacgcctcatgcaagcgctga

DBGET integrated database retrieval system