KEGG   Aureimonas sp. AU20: M673_15965Help
Entry
M673_15965        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K02037  phosphate transport system permease protein
Organism
aua  Aureimonas sp. AU20
Pathway
aua02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aua00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    M673_15965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aua02000]
    M673_15965
Transporters [BR:aua02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    M673_15965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3708 BPD_transp_1 DUF1461
Motif
Other DBs
NCBI-ProteinID: ALN74222
UniProt: A0A0S2ESK2
LinkDB All DBs
Position
complement(3416586..3418061)
Genome map
AA seq 491 aa AA seqDB search
MSAFALILIVLAIGLVGYGLGRRKGAALPDSPGAKVHSRPTYHGSFVFCWAVVPALIVMV
LWLSISPAVIFATVERRLEADTQAASVSLGRSLVRSLGQGIRALPSDEQAGLSSARIADI
QPLFERRGIPLPGGATDAMIPIALEKNHMEDMSRLALTGVTLVLAIGGLLFGLSRIAVRL
RARNQVERVVKTFLVVCSSIAILTTVGIVCSMLFESLDFFSRIRPVDFFFGTVWEPRFAA
AGSEAAGQFGLIPLLAGTLYIAFVAMLFAVPVGLFAAIYMAEYASSRVRSVVKPLLELLA
GIPTIVYGFFALITVGPFLRDISASINGLLTGNYVGFIQAQSILTAGLVMGIMLIPFVSS
LSDDIITAVPRSLRDGSMGLGATPSETVKKVVLPAALPGIVSALLLTASRAIGETMIVVL
AAGIAANITLNPFEAMTTVTVKIVSQLTGDLDFTSPQSLVAFALGITLFVLTLILNIIAL
AIVRKYREQYD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcatttgctctgattctgattgtcctggcgatcggtctggtcggctatgggctt
ggccgccgcaagggcgccgcgctgccggattcgccgggcgccaaggtgcattcgcgcccg
acctatcacgggtccttcgtcttctgctgggccgttgtgcccgccctgatcgtcatggtg
ctttggctgtcgatctcgccggcggtgatcttcgccaccgtcgagcgccgcctcgaggcc
gacacgcaggccgcctcggtctcgctcggccgctcgctcgtgcgctccctcggccagggc
atccgcgccttgccgtcggacgagcaggccggtctttccagcgctcgcatcgccgacatc
cagcctttgttcgagcgccgcggcattccgctgccgggcggcgcgaccgacgcgatgatc
cccatcgcgctcgaaaagaaccacatggaggacatgagccggctcgccctgacaggcgtg
accctggttctcgcgatcggcggccttctcttcggcctgtcgcgtatcgcggtccggctt
cgcgcccgcaaccaagtcgagcgggtggtcaagaccttcctcgtggtctgctcctcgatc
gccattctcaccaccgtcggcatcgtctgctcgatgctgttcgagtccctcgacttcttc
agccgcatccgcccggtcgacttcttcttcggaacggtctgggagcctcgcttcgcagcc
gccggttccgaggccgccggtcagttcggcctgatcccgcttctggcgggcacgctctac
atcgccttcgtggccatgctcttcgccgtgccggtcggcctcttcgccgccatctacatg
gccgaatacgcctccagccgcgtgcgctcggtggtgaagccgctgctcgaactcctggcc
ggcattccgaccatcgtctacggcttcttcgcgctcatcaccgtcggccccttccttcgc
gacatctcggccagcatcaacggcctgctcaccggcaattatgtcggcttcatccaggcg
cagtcgatcctgacggcgggtctggtgatgggcatcatgctcatccccttcgtgtcctcc
ttgtcggacgacatcatcaccgccgtgccgcgctctctgcgcgacggctcgatggggctc
ggcgccacgccgtccgagacggtgaagaaggtggtgctgcccgccgccctgccgggcatc
gtgtcggcgctgctgctgacggcctcgcgcgccatcggcgagaccatgatcgtggttctg
gccgccggtatcgccgccaacatcacgctcaacccgttcgaggcgatgactacagtcacc
gtcaagatcgtctcgcagctcaccggtgatctcgacttcacctcgccgcagagtctggtg
gccttcgcgctcggcatcacgctcttcgtgctgacgctgatcctcaacatcatcgccctt
gccatcgtgcgcaagtatcgggagcagtacgactga

DBGET integrated database retrieval system