KEGG   Aureimonas sp. AU20: M673_17030Help
Entry
M673_17030        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00500  Starch and sucrose metabolism
aua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M673_17030
Enzymes [BR:aua01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M673_17030
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     M673_17030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ALN74435
UniProt: A0A0S2ET46
LinkDB All DBs
Position
complement(3639646..3641283)
Genome map
AA seq 545 aa AA seqDB search
MFNLWYKNAVIYCVDVETFQDSDGDGIGDFKGLTSRLDHIEALGATCIWLLPFYPSPNRD
NGYDVADYYNVDPRYGTLGDFVEFTHAAHERGLRVLVDLVVNHSSIDHPWFQASRMGDPK
YRDWYVWRKDKPADAEKGVIFPGVQKTTWTRDTKRREYYFHRFYEHQADLNIANPRVREE
IERIMGFWLALGVSGFRMDAVPFMLEDLSAAHSGWEPYRYLSQLQTFLSWRRSEAILLAE
ANIPMDEAPDYFGTGDRLHVIFNFPLNQQMFLAFARGEAGPVSDFLKALPEIPGPAQWAT
FLRNHDEIDLGRLETEEREEVFAAFGPEEDMQLYDRGLRRRLAPMLGGDERRLAMAFSVM
LALPGTPVLWYGDEIGMGEDLGLPERHSVRTPMQWSAAENGAFSTAKPKDCVRPSVSDGP
FAYPHVNVARQKLDPLSLLSQVRRLIRARREAREIGWARPQVLDAGDASVLALVSRWRGG
GVLTLHNLADRPALARLPEGLPFEAMSPLLRQGVHISPEDRTLRLDAYGFEWFHFDAATD
DETDE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatctctggtataagaacgcggtgatctactgcgtcgacgtcgagacgtttcag
gactcggacggcgacgggatcggcgacttcaagggcctgacgagtcggctcgaccatatc
gaggcgctgggcgcgacctgtatctggctgctgcccttctacccaagccccaatcgcgac
aatggctacgacgtcgcggactattacaacgtcgatccgcgctacggcacgcttggcgac
ttcgtggagttcacccatgccgcgcacgagcggggcttgcgcgttctcgtcgacctcgtg
gtcaaccattcctcgatcgaccacccctggttccaggccagccgaatgggcgacccgaaa
tatcgagactggtatgtctggcgcaaggacaagccggcggatgccgagaagggcgtgatc
tttcccggtgtgcagaagacgacttggacgcgcgacaccaagcgccgggaatattacttc
caccggttctacgagcatcaggccgatctcaacatcgccaacccccgggtgcgcgaggaa
atcgagcgcatcatgggcttctggctggcgctcggcgtgtcgggcttccgcatggacgcg
gtgcccttcatgctggaggacctgtccgccgcccattcgggctgggagccctatcgttac
ctgtcgcagcttcagaccttcctctcgtggcgcaggtccgaggcgatcctgctggccgag
gccaacattccgatggacgaggcgccggactatttcggcacgggcgaccggctgcacgtc
atcttcaacttcccgctcaaccagcagatgttcctggccttcgcgcgcggcgaggccggg
ccggtgtcggatttcctgaaggcgctgccagaaattcccggcccggcgcaatgggcgacc
ttcttgcgcaatcacgacgagatcgatctcggccggctggagacggaagagcgcgaggag
gtcttcgccgccttcggcccggaggaggacatgcagctctacgatcggggcctgcgccgg
cgccttgcgcccatgttgggcggcgacgagcggcggctcgccatggccttctcggtgatg
ctggcgctgccgggcacgccggtgctctggtatggcgacgagatcggcatgggagaggat
ctgggcctgccggagcgccattccgtgcgcacgcccatgcagtggagcgcggccgagaac
ggcgccttttccacggccaagcccaaggactgcgtacgcccctcggtgtcggacgggccc
ttcgcctatccgcatgtgaacgtggcgcggcagaaactcgacccgctgtcgcttctctcc
caggtgcgccggctcatccgcgcccggcgcgaggcgcgcgagatcggctgggcgcgaccg
caggtgctggacgccggggacgcctcggtgctggcgctcgtgtcgcgctggcgcggcggc
ggggttctgaccctgcacaatctcgccgaccggccggcgctggcgcgtctgccggagggc
ctgcccttcgaggcgatgagcccgctcctgcgccagggcgtgcatatctcgcccgaggac
aggacgctgcggctcgacgcctacgggttcgagtggttccacttcgatgccgcgacggac
gacgagacggacgagtga

DBGET integrated database retrieval system