KEGG   Aureimonas sp. AU20: M673_20785Help
Entry
M673_20785        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00040  Pentose and glucuronate interconversions
aua00051  Fructose and mannose metabolism
aua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M673_20785
   00051 Fructose and mannose metabolism
    M673_20785
Enzymes [BR:aua01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     M673_20785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ALN75172
UniProt: A0A0S2EV77
LinkDB All DBs
Position
pAU20b:257455..258441
Genome map
AA seq 328 aa AA seqDB search
MTLSRFATRLNSFGSAPHLFWPDLQGKPSFMQMAERAATAKGLTDVDLNFPDHVTDEPGL
VGRRINDLGLAINGLAMRYYTNPAFKLGAFTNPDKAVRREAIDLTKRGIDAARAMGADLM
TLWLGQDGFDYNFQLDYAEAWDLEIDGIREVAEHDPACRVSIEYKPDEPRAHALLRDCAT
TLLAIQDAGCSNLGVTLDFAHALYAGEQPAYAAHLIHRRSKLMGVHLNDGYAKRDDGLMV
GAVHLRSTLELLRQIRRDGYEGALYFDTFPDASGLDPVAECETNIATVQQLLAVATRLDA
DNRLGEAQSRQDGVASQSIVNQALIAAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttctcgcttcgccacgcgcctgaactccttcgggtccgccccgcatctcttc
tggccggacctgcagggcaagccgagcttcatgcagatggccgagcgagccgcgaccgca
aagggcttgacggatgtcgatctgaacttccccgaccatgtgacggacgagccgggcttg
gtcggccgtcgcatcaacgatctcggcctcgccatcaacggcctcgccatgcgctactac
acgaaccccgcctttaagctgggtgccttcacgaatcccgataaagccgtgaggcgcgag
gcgatcgatctgaccaagcgcggcatcgacgcggcgcgggccatgggcgccgacctgatg
acgctctggctcgggcaggacgggttcgactacaatttccagctcgactatgcggaggcc
tgggacctggaaatcgacggcatccgcgaggtcgccgagcacgatccagcctgccgcgtt
tccatcgagtacaagcccgacgagccgcgcgcccatgcgctcttgcgcgactgcgccacc
acgctgctcgccatccaggacgccggctgttccaatctcggcgtgacgctcgactttgcc
catgcgctctatgccggcgagcagccggcctatgccgcccatctcattcatcgccgctcc
aagctcatgggtgtccatctcaacgacggctacgccaagcgagacgacggcttgatggtg
ggcgcggtgcacctgcgctcgaccctggagctgctgcgccagatccgccgcgatggctac
gagggcgcgctctatttcgacacgttccccgacgcttcgggcctcgaccccgtggccgag
tgcgagaccaatatcgcgaccgtccagcagcttttggcggtcgccacgcgcctcgacgcc
gacaatcgcctcggcgaggcgcagtcgcgccaggacggcgtcgccagccagagcatcgtc
aaccaggcgctgatcgcggcggcctga

DBGET integrated database retrieval system