KEGG   Aureimonas sp. AU20: M673_22020Help
Entry
M673_22020        CDS       T04161                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aua  Aureimonas sp. AU20
Pathway
aua00564  Glycerophospholipid metabolism
aua01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M673_22020
Enzymes [BR:aua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M673_22020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALN75420
UniProt: A0A0S2EVR6
LinkDB All DBs
Position
pAU20c:81374..82882
Genome map
AA seq 502 aa AA seqDB search
MAQFDVFIIGGGINGCGIARDAAGRGYSVGLAEMNDLASGTSSWSTKLIHGGLRYLEHYE
FRLVREALAEREVLWRIAPHIVRPLRFVLPYHKGLRPAWLLRLGLFLYDHIGGRRQLPAT
SGVDLAGPLGAPLKTGFTKGFEYSDARVDDARLVVLNARDAEARGAEIMVGTEVTEARRE
GALWRIRLRDRRAGGTERVVTARFLVNMAGPWVDRVIQRALGQSEARHVRLVQGSHIVTR
KLFHHDRAYIFQNADQRIVFAIPYERDFTLIGTTDRDYDGDPAKVAITDEESDYLCRAAS
DYFERPVTRADIVWTYSGVRPLFDDGASKAQEATRDYVLKVEGDAARGEAGLLNGFGGKI
TTYRKLAEDALERIGERIGAKGAPWTGSRPLPGGDFATDGVGAIEAELSRLAPALDQATV
SRMVSAYGRDALGIAGNGLGRDLGHGLFEAELGWLVEREWARTAEDVLWRRSKLGLRFSA
TEVEALERAIEGLVAIRKTAAA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagttcgacgtcttcattatcggcgggggcatcaacggctgcggcatcgcgcgc
gacgccgccgggcgcggctacagcgtcggtctcgccgagatgaacgacctcgcctccggc
acgtcctcctggtccaccaagctgatccatggcggattgcgctatctcgaacactacgag
ttccgactggtgcgcgaggcgctggccgagcgcgaggtgctctggcgcatcgcgccccat
atcgtgcgcccgctgcgcttcgtgctgccctatcacaagggcctgcgcccggcttggctg
ctgcggctcggcctgtttctctacgatcatatcggcgggcggcggcagttgccggccacg
agcggcgtcgatctcgccggcccgctcggcgcgccgctgaagaccggcttcaccaagggc
ttcgaatattccgacgcgcgggtggacgacgcgcggctggtggtgctcaacgcgcgggac
gccgaggcgcgcggcgccgagatcatggtcgggacggaagtcaccgaagcccggcgcgaa
ggcgcgctctggcgcatccggctgcgggaccggcgcgcgggcggcactgagcgggtggtc
accgcgcgcttcctcgtcaacatggcggggccgtgggtggatcgcgtgatccagcgcgcg
ctcggccagagcgaggcgcggcacgtgcgcctcgtgcagggctcgcacatcgtcacgcgc
aagctcttccaccacgaccgcgcctatatcttccagaacgccgaccagcgcatcgtcttc
gccattccctacgagcgcgacttcacgctgatcggcacgacggaccgggactatgacggc
gacccggccaaggtcgccatcacggacgaggaatccgactatctctgccgcgccgcctcg
gactatttcgagcgcccggtgacgcgggccgacatcgtctggacctattccggcgttcgc
ccgctcttcgacgacggcgcctccaaggcgcaggaggcgacgcgcgactatgtcctcaag
gtcgagggcgatgcggcgcgcggcgaggcggggcttttgaacggcttcggcggcaagatc
accacctatcgcaagctggccgaagacgcgctggagcgcatcggcgagcgcatcggcgcc
aagggcgcgccctggacaggcagccgccccctgcccggcggcgacttcgccaccgacggc
gtcggcgcgatcgaggcggagctttcgcgtctcgcccccgcgctggaccaggcgacggtc
tcgcgcatggtctcggcctatgggcgggacgcgctgggtatcgcaggcaacggtcttggc
cgcgatctcgggcatggcctcttcgaggccgagctcggctggctggtggagcgcgaatgg
gcgcgcacggccgaggacgtgctctggcggcgatccaagctcggcctgcggttctcggcc
acggaggtcgaggcgctggaacgggccatcgaaggtttggtggcgatccgaaagaccgcc
gccgcttga

DBGET integrated database retrieval system