KEGG   Aureitalea sp. RR4-38: C5O00_04490Help
Entry
C5O00_04490       CDS       T05335                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00620  Pyruvate metabolism
aue00680  Methane metabolism
aue01100  Metabolic pathways
aue01120  Microbial metabolism in diverse environments
aue01200  Carbon metabolism
Module
aue_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C5O00_04490
  09102 Energy metabolism
   00680 Methane metabolism
    C5O00_04490
Enzymes [BR:aue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C5O00_04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AVI50462
UniProt: A0A2S0HUX8
LinkDB All DBs
Position
1007978..1010545
Genome map
AA seq 855 aa AA seqDB search
MKHTKEERFNKHVLSRYQIYNSIFMTLPFDAITRTGVMLPLFQEVCKNGFKENKNPTEIV
ASFFSKYTDNPTPEERINLLFRFIQYIERQVVLFDAIEDAAFTTINNMDGRGTLRNSKEE
AEDKNKKEELKAYLHRFKIRPVLTAHPTQFYPGAVLGIITDLAKAIEATDLELIKKLLAQ
LGKTPFFKKQKPTPYDEAVRLIWYLENVFYHSVSDIYAYIRNNIFEGELPGNEVIQLGFW
PGGDRDGNPFVTTETTLQVAYRLRSTLLKSYYRDLRSLRRRVTFEGVDVLVERLETEVYA
NISLQHGKITLNAETILEQLSAIKDILVRDHQSLFVDMVDDMINKVNLFGMHFAVLDIRQ
DSRIHTQVMMAIAKAKPELFPKEYMEMSTAERIDFLVRLKGDIDPRSVGDELAEKTLGSI
RAMQIIQENNGETGCNRYIISNNQTAENVLEVFAMLRLSGWNEPTVDVVPLFETVDDLRA
ASDVMEVLYSNPEYAAHLKRRGKNQSVMLGFSDGTKDGGYLMANWSIFTAKERLTEVSRK
YGISVIFFDGRGGPPARGGGKTHQFYASLGPTIEKEEVQLTIQGQTISSNFGTRESCQYN
LEQLLSSGISNAVFTDDSASLNGEQRETMTRLANLSYEAYSDFKQHPKFLAYLEQMSTLK
YYAMTNIGSRPSKRGKSSELVFSDLRAIPFVGSWSQLKQNVPGFYGVGYALQKYKEEGAF
DKVRALYSHSMFFRTLLENSMMSLTKSFFPLTAYMKDDPEFGEFWTLVHEEYLRSKELLL
ELSGQSQLMEESKAMRASIAVREEIVLPLLTIQQYALREIQKLKKENAPEAELAVWEKMV
TRSLFGNINASRNSA
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatactaaagaagaacgttttaataaacatgtcctctcccgatatcagatatac
aacagtatattcatgaccttgccgttcgatgctatcaccagaacaggagtaatgttaccc
ctgttccaggaggtttgtaaaaatggatttaaagaaaataagaaccctaccgagatcgta
gcatccttcttttcaaaatatacagataatcccacccctgaggaacgcataaatctactt
ttcagatttatacaatacatagaaagacaagtggtactgttcgacgccattgaagatgca
gcgtttacaactatcaataatatggacggaaggggaacgctaaggaatagcaaagaagaa
gccgaagacaagaataagaaagaggaactaaaagcgtacctgcatcgttttaagatacgg
cctgtgcttacggctcaccctacccagttttatcccggggcagttctgggcatcataaca
gatctggctaaggctattgaggccaccgacctcgaacttatcaagaaattactggcacag
ttaggaaaaacgcctttctttaagaaacagaaacctacgccttatgacgaagcagttagg
cttatctggtatcttgaaaacgtcttctatcattcggtaagcgatatctacgcctatatt
cggaataatatttttgaaggcgaattaccgggcaacgaagtgatccagctgggattctgg
ccgggaggtgacagagacgggaatccgtttgtaaccaccgaaacaaccctgcaagttgcc
tatcgtttacgctcaactttactgaaaagttactatcgcgacttgcgctcgctgcggcgc
cgggttactttcgagggggtagatgtcctggtggaacggctggagaccgaggtatatgct
aacatttctcttcaacatggtaaaataacgctcaatgccgaaactatccttgaacaactt
agtgcgataaaagatattctcgttcgagaccaccagtcgctattcgttgatatggtagat
gatatgatcaataaggtgaatctcttcggaatgcattttgccgtgctcgatatcaggcag
gattcgagaatacatacccaggtgatgatggccattgcaaaggccaaacctgaattattt
ccgaaggaatacatggaaatgtcgacagccgaaagaatcgattttcttgttcggctgaaa
ggtgatatagatcctcgctctgtaggtgacgaactagcagaaaaaacccttggctcaatc
agggctatgcagatcatccaggaaaataatggagaaaccgggtgcaatcgatatattatc
agtaataatcaaacggccgaaaatgtattagaggtctttgctatgctcaggctatctgga
tggaacgaacctactgtggacgtagttccattattcgaaactgtggacgatcttcgggcg
gcaagtgatgtcatggaagttttatattccaaccccgaatacgctgctcacctaaaacgt
agaggtaaaaaccagtctgttatgcttggtttcagcgatggaacaaaagatggaggctac
ctgatggcaaactggagcatatttacagctaaggagcgtcttacagaggtgtcgagaaaa
tatggcattagtgtgatctttttcgatgggcgtggaggtcctccggcaagaggtggagga
aaaacccatcaattctacgcatctctgggccctacaattgaaaaagaagaagtacagctt
accatacaagggcaaacaataagttctaatttcggaactcgggaatcttgtcaatacaat
ctcgaacaattattaagttcgggaatttcaaatgcagtattcacagacgatagtgccagc
ctgaatggggagcaacgggaaaccatgacaagactggccaatttaagttatgaggcctat
tcagatttcaaacaacaccccaaattcttggcatatctagagcagatgagcaccttaaaa
tattacgctatgacgaatattgggagtcggccttcaaagagaggaaagagtagtgaatta
gttttcagcgaccttagggcgattccctttgtaggtagctggagtcagctaaaacaaaat
gtccccggattttatggcgtaggttatgctttgcaaaaatataaagaggaaggagccttt
gataaggtgcgcgcattatattcgcattccatgttcttcagaaccttattagaaaatagt
atgatgagccttaccaagtctttcttccctctaaccgcctatatgaaggatgatcccgaa
tttggagaattctggacccttgttcatgaggagtaccttcggtctaaagaactattacta
gagctaagtggccaatcgcagttaatggaagaaagtaaggcaatgagagcatccatcgcg
gtaagggaggaaattgttttacctctgcttaccatacaacaatacgcgctgcgggagatt
cagaaattaaaaaaagaaaacgccccggaagcagagctggccgtatgggaaaagatggtt
acgcgaagtttatttggtaatattaacgccagccgcaatagtgcgtaa

DBGET integrated database retrieval system