KEGG   Aureitalea sp. RR4-38: C5O00_04990Help
Entry
C5O00_04990       CDS       T05335                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00240  Pyrimidine metabolism
aue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C5O00_04990
Enzymes [BR:aue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C5O00_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AVI50557
UniProt: A0A2S0HV50
LinkDB All DBs
Position
1124359..1124997
Genome map
AA seq 212 aa AA seqDB search
MFLENTVNQKEQFGWIEVICGSMFSGKTEELIRRLKRAKFARQRVEIFKPAVDQRYDEDK
VISHDSNEIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVKVCNDLANSGVRVIVAG
LDMDYKGNPFGPMPNLMATAEYVTKVHAVCPRTGNLAHYSFRKGNSDELVLLGETDEYEP
LSRAAYYKAVLREKVKKMDVKDPIELPSKKQA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaataccgtaaatcagaaagagcagtttggctggatcgaagtgatctgc
gggtctatgttttcgggtaagacagaggaactcatccgaagattaaaaagagccaagttt
gcacgtcaacgtgtcgagatcttcaaacctgcagtagatcaacgctacgacgaggataag
gtgatctctcatgatagtaatgaaattagatcgacgccggtacctgctgctgctaatatc
cctattctcgccgacggctgtgatgtagtgggtatagatgaggcacaattcttcgatgac
gaaattgtaaaagtttgtaacgatcttgccaatagcggcgttcgtgtgatcgtggcaggg
ttggatatggattataaagggaaccccttcgggcctatgccaaatctcatggcgacggcc
gaatatgtaaccaaagtgcacgccgtttgtccgcgaacaggaaacctcgcccattacagc
ttcagaaagggaaatagtgacgagctggtgttactgggagagaccgacgaatacgaacct
ttaagccgtgcggcctattacaaagctgtcctgagggaaaaagtaaagaaaatggatgtg
aaggatcccatcgaattaccttcaaaaaagcaagcatag

DBGET integrated database retrieval system