KEGG   Aureitalea sp. RR4-38: C5O00_06435Help
Entry
C5O00_06435       CDS       T05335                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aue  Aureitalea sp. RR4-38
Pathway
aue00564  Glycerophospholipid metabolism
aue01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aue00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C5O00_06435
Enzymes [BR:aue01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C5O00_06435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 HI0933_like NAD_binding_8 Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AVI52350
UniProt: A0A2S0I0G2
LinkDB All DBs
Position
complement(1462013..1463563)
Genome map
AA seq 516 aa AA seqDB search
MLLQLETVEEWDLIIIGGGASGLGIAVDAVTRGFKTLLLEQYDFAKGTSSKSTKLLHGGV
RYLAQGNIKLVIEALEERGLLARNARHLFKKQEFIIPNFTWWGGYYYVIGLKFYDLLSKK
LSLGSSRRVNKDKIQSYLPTLKRDKLVSGVSYFDGQFDDARLALNLAQTAIEHGGTALNY
MKVTSLLKNDEGKVCGVTTVNTETDRRYSVKAKVVINATGIFTDKILKMQDPNHKKTVVP
SQGIHLVLDRSFLNSDKAIMIPKTSDGRVLFVIPWHDKVIAGTTDTLIKKPKIEPRAQET
EIDFILETINLHLSKKASRKDVLSIFSGLRPLVKPKGDEVKTKEVSRSHKIIVSGQLVSI
IGGKWTTYRKMAEDVVDKVIKTYGFRKSRSVTKDIAIHGNVKPAEEIRHDHLFIYGSEVE
KYLRFEASKPEYKDKIHPEYPYTVGQIVWSIRFEMARTVEDFLGRRIRLLLLDTRAAMYA
SKMVSEIMAEEFGYDKHWAHKQEQDFLSLANTYIIK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttattgcaactggaaacagttgaagaatgggaccttatcatcattggaggtggagcc
agcggtttaggtatagcggtagatgcagtaacgagagggtttaaaacgcttcttttggaa
caatatgattttgccaaaggaacttccagtaagagcaccaagctgctgcacgggggagta
cgttatctggcccagggaaatataaagttggtgattgaggctcttgaagaaagaggcctg
ctggcacgtaacgcacgccacttatttaagaaacaggaatttattatcccaaacttcacc
tggtggggaggatattactatgtgatcggacttaaattttacgatctactttctaaaaaa
ttaagcctgggaagttccaggcgggttaataaagacaaaatacaatcttacttaccaacc
ctaaaaagagataagcttgtaagtggagtttcttatttcgacggacaattcgatgatgcc
agactcgcacttaatctggcgcaaactgccatagaacacggaggtactgccttgaactat
atgaaagttaccagccttctcaagaatgatgagggtaaagtatgtggagttacaactgta
aataccgaaacagacaggagatattctgtaaaagctaaagttgtgataaatgcaaccggg
atctttacagacaagatcctgaaaatgcaggatcccaaccacaagaaaacagttgtcccc
agccagggtattcatttggttctggatcgttcatttcttaacagcgataaagcgataatg
attcctaaaacctccgacggacgtgtgctgttcgttatcccctggcatgataaagtaatt
gccggaacaaccgatacccttattaaaaagccaaagatcgaaccccgggcacaggagacc
gagatcgattttattttggagaccatcaaccttcacctcagcaaaaaagcaagccgaaaa
gacgtcctatcgatcttttcgggcctacggcctcttgtcaagccgaagggagatgaagtt
aagaccaaagaagtttcccgcagtcataagataattgttagtggtcaactagttagtatt
atagggggtaaatggaccacctatcgaaaaatggccgaagacgtggtggataaagttatt
aagacctatgggtttcgcaaaagcaggtcggtaacaaaggatattgcaatacacggaaac
gtgaaacctgctgaagaaattagacatgaccacctttttatttatggttcggaggttgaa
aaatatctcaggttcgaagcctcaaaacccgaatataaggacaaaatacatccggaatat
ccatatactgttgggcagatagtctggagtatacggtttgaaatggcccgcactgttgaa
gatttcctgggaagaagaattcgtttgttactattggatacaagggccgcaatgtatgcc
agtaaaatggtgtctgaaattatggccgaagaatttggatacgacaagcattgggcacat
aagcaagagcaggattttctttcattagctaatacatatattatcaaataa

DBGET integrated database retrieval system