KEGG   Acinetobacter ursingii: URS_1590
Entry
URS_1590          CDS       T06299                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
aug  Acinetobacter ursingii
Pathway
aug01040  Biosynthesis of unsaturated fatty acids
aug01100  Metabolic pathways
aug01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aug00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    URS_1590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aug01004]
    URS_1590
Enzymes [BR:aug01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     URS_1590
Lipid biosynthesis proteins [BR:aug01004]
 Desaturase
  First
   URS_1590
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-ProteinID: BBF77595
UniProt: A0A3G9FVA3
LinkDB
Position
1:complement(1628566..1629741)
AA seq 391 aa
MEMNTPVTQAPINWIAIFALVFLPIVAVIAIPLYAYHHDFSLASWVSMFVLLGMSSLGIT
AGYHRLWAHRAYEATLPLKIILMIMGTFAVQNSILFWASGHRTHHRHVDDIEKDPYSIKK
GFWYAHLGWMLRDYPAAEPNFKNAPDLLNDKLVMFQHKYYIPLVIAVHVVILGAVGWAVG
DVWGVMLLGGLVRLILSHHVTFFINSLCHMWGKRPYTDENTARDNFWLAIATWGEGYHNY
HHIFQYDYRNGVKWWQYDPTKWLIWSCSKLGLAKNLRRIPSFNIQKAELAMRFKYAEQDL
AIYGHDVNTDLAQMKQRIAQEYEAFTLTLNDWAKLKEQELHAKKAAMAEKIHQMDHKLKV
DFQLLEHRLSHHRECLETLMRNVKKRNAVSE
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggagatgaatactcccgtaactcaagccccaatcaactggattgcaatttttgcttta
gtttttttaccgattgtcgcggttattgcgatcccactttacgcttatcaccatgatttt
agcttggcatcatgggtgagtatgtttgtacttttaggtatgagcagtctaggtattacg
gctggttatcatcgcctgtgggcacatcgcgcctatgaagcgactttaccgttaaaaatc
atcctgatgattatgggaacctttgcggttcaaaacagtatccttttctgggcttcagga
caccgtacccatcatcgccatgtagacgatattgaaaaagatccatattccatcaaaaaa
ggcttctggtacgcacatcttggctggatgttacgtgactacccagcagcagaaccaaat
ttcaaaaatgcaccagatctactcaatgacaaactggtgatgttccaacacaaatattac
attccactggtcattgcggttcatgtcgtcattctgggtgctgtgggttgggctgtcggt
gatgtttggggcgtcatgctgttaggtggtctggttcgtttaattttgagccatcatgtg
acgttctttattaactcactgtgtcatatgtggggcaaacgtccttatactgatgaaaac
acggcacgtgataatttctggctcgcgattgcaacttggggtgagggttatcataactac
catcatatcttccaatacgactaccgtaatggggtgaaatggtggcaatatgacccaacc
aaatggctaatctggtcatgttcaaaactgggcttagcgaaaaacttgcgccgtattcca
agttttaacattcaaaaagctgagttagcgatgcgttttaaatatgcagagcaagatttg
gctatctatggtcatgatgtcaacactgaccttgctcaaatgaagcagcgtattgctcaa
gagtatgaggcatttactctgacacttaatgactgggcgaagttgaaagaacaagagttg
catgctaaaaaagccgcaatggcagaaaagattcatcaaatggatcataaacttaaagtc
gattttcaattactcgaacatcgtttaagtcaccatcgcgaatgtctggaaactttgatg
cgtaatgtcaaaaaacgcaatgcagtttctgaataa

DBGET integrated database retrieval system