KEGG   Acinetobacter ursingii: URS_2307Help
Entry
URS_2307          CDS       T06299                                 

Definition
(GenBank) alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aug  Acinetobacter ursingii
Brite
KEGG Orthology (KO) [BR:aug00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    URS_2307
Enzymes [BR:aug01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     URS_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 FAD_oxidored Thi4 NAD_binding_8 Glutaredoxin Shikimate_DH DAO K_oxygenase Cytochrom_C_2 FMO-like AlaDh_PNT_C Glucosamine_iso Spermine_synth
Motif
Other DBs
NCBI-ProteinID: BBF78288
UniProt: A0A3G9G1Y4
LinkDB All DBs
Position
1:2370652..2372211
Genome map
AA seq 519 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDDSDKAAKIKELVTEIAELSDQVTARFDGQNTR
RPSFGIAKVGEQPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDELLNQIKGLNLKADF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGAFFQDEVEQRKIMAVPMVFQDGNHI
GQGRMTLEEIVAKLDSGAAEKDAAAINAKQAFDVLVVGAGPAGGTAAIYAARKGIRTGMI
AERFGGQVMDTMDIENFTSVQKTVGPQFAADMEKHVREYDVDIMNLQRVSKIVGADQTAS
GLVEVELENGAKVESKTVILSTGARWRKMGVSGEQEYATRGVAYCPHCDGPLFKGKKVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLRNATVITHALSTEVVGD
GAQVTALKYKDRATDTEHSIELSGIFVQIGLLPNTDFLKGSVELSPRGEIIINERNETNV
AGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatatcaaaactcagttaaaagcctatttagaacgtttagaaagtcct
atcgaattggtcgctgctctggatgattcagacaaagctgccaaaatcaaagaattggtt
actgaaattgcggaactctctgatcaagtcacggcccgttttgatggtcaaaatacacgc
cgtccaagttttggtattgccaaagtcggtgaacaaccacgtgtgttctttgcgggttta
ccgatgggtcatgagtttacctcattgatcttagccttattacaaacttcaggttatgcc
ccgaaagtctctgatgagctgctcaaccagattaaaggtttgaatcttaaagcagacttt
gatgtatttgtatctttgagctgtcataactgtccagatgtggttcaggcactgaatctg
attgcgatttataaccccaataccactgcgaccatgattgatggtgccttcttccaggat
gaagtggaacaacgcaaaatcatggcagttccgatggtattccaagatggcaatcatatc
ggtcaaggtcgtatgaccttagaagaaattgtggcaaaactggacagtggagctgctgaa
aaagatgcggcggcaattaatgccaaacaggcttttgatgtattagtggtcggtgcgggt
cctgcgggcggtactgcggcgatttatgcagcacgtaaaggcattcgtacaggcatgatc
gcagagcgttttggtggtcaggtcatggacaccatggacattgaaaactttacttctgta
caaaaaactgtaggtccacagtttgctgcggatatggaaaaacatgtacgtgagtacgat
gtggacattatgaatctgcaacgtgtcagtaaaattgtcggtgccgatcaaactgcttca
ggtctggtggaagttgaactggaaaatggtgccaaagttgaatcgaaaaccgtgatttta
tcgacaggtgcgcgctggagaaagatgggcgtttcgggtgaacaggaatatgcgactcgt
ggtgtagcgtattgtccacactgtgatggcccattattcaaaggcaaaaaagttgcggta
attggtggtggtaactcgggtgttgaagcggcaattgatctggcaggtattgtggagcat
gtgactttggttgagtttgataccaaacttcgtgcagaccaagtgttacaggacaaatta
aatagcttgcggaatgcgactgtaatcacccatgcactttcaactgaagtcgtcggtgat
ggtgctcaggtgaccgctttgaaatataaagaccgtgccacagatacagaacacagtatt
gaactgtcaggaatttttgtacagattggtttattgccaaatacagatttcttgaaaggt
tcagtcgagttaagtccacgtggtgaaattattatcaacgagcgtaacgaaaccaatgta
gcaggtgtatttgctgcgggtgactgtaccactgtgccatataagcagatcattattgcc
acgggtgaaggggcgaaagcatctctgtcagcgtttgattatattattcggaatagttaa

DBGET integrated database retrieval system