KEGG   Aerococcus urinaehominis: AWM75_02925Help
Entry
AWM75_02925       CDS       T04284                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
auh  Aerococcus urinaehominis
Pathway
auh00010  Glycolysis / Gluconeogenesis
auh00020  Citrate cycle (TCA cycle)
auh00620  Pyruvate metabolism
auh01100  Metabolic pathways
auh01110  Biosynthesis of secondary metabolites
auh01120  Microbial metabolism in diverse environments
auh01130  Biosynthesis of antibiotics
auh01200  Carbon metabolism
Module
auh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:auh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWM75_02925
   00020 Citrate cycle (TCA cycle)
    AWM75_02925
   00620 Pyruvate metabolism
    AWM75_02925
Enzymes [BR:auh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWM75_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 RnfC_N GCV_H HlyD_D23 DUF2118 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AMB99013
UniProt: A0A0X8FKI5
LinkDB All DBs
Position
complement(669756..671393)
Genome map
AA seq 545 aa AA seqDB search
MAYVFNLPDVGEGMAEGEIVSWLVAEGDQVNEEDPIVEIQNDKSVEEIYSPVSGKVTKLH
YAEGDVAMVGTPLITFEGEGLPDNEETAAPSSPASPAQEEKAADPATSSSAGGSYYQFVL
PDVGEGMAEGEIVEWLVAEGDEINEEDSLVEIQNDKSVEEVASPVSGKVVRILVEPGTVA
NVGDVLAEIDSPDHNGEGAASTPASPAQEEKAEDPAKGASSNAASSGVPEAADPNRRVLA
MPSVRQYAREKGVDITQVQGSGKNGRVVREDIDNFDGSAAAAPAAEAPAQAEKAGKPAKE
KAAFKSSADYAEMEERIPMTPMRKAISKAMETSAYTAPQVTLFKNVEVSKLWDHRKKFKG
VAAERDTKLTFLPYVVKALVAAVKKYPALNASVDDANQEFVHKNYYNVGIATDTDQGLFV
PNIKDADKKSMFDIADEITEKAGKAHAGELSAGEMRDGTVTISNIGSVGGEFFTPILNYP
EVAILGVGTIKQEPIVNEDGEITVGRVTKLSLVFDHRIVDGATGQQALNEIARLLADPEL
LLMEG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgtatttaacttacctgatgtcggtgaaggtatggcagaaggagaaatcgtt
tcatggttagtcgctgaaggtgaccaagtaaacgaagaagatccgattgttgaaatccaa
aacgataaatcagttgaagaaatctattctccagtatctggtaaagtaaccaaattacac
tacgctgaaggcgatgtggcaatggttggtacacctttaattacctttgaaggtgaaggc
ctacctgataacgaagaaacagctgcgccatctagcccagcatcaccagcccaagaagaa
aaggctgcagatccagcaacatcttcatcagctggcggttcttattaccaattcgtctta
cctgacgttggtgaaggtatggccgaaggtgaaatcgttgaatggttagttgcagaaggc
gacgaaatcaacgaagaagattcactagttgaaatccaaaatgacaaatcagttgaagaa
gtggcttcaccagtatctggtaaggttgttcgtatcttagttgaacctggtactgttgct
aacgttggtgacgtcttggctgaaatcgattcaccagaccacaacggcgaaggtgctgct
tcaacaccagcatcaccagcccaagaagaaaaagcagaagaccctgctaaaggcgcctct
tcaaacgctgcttcttcaggagtgcctgaagctgctgatccaaaccgtcgtgtactagct
atgccttcagtgcgtcaatatgctcgcgaaaaaggcgttgacattacccaagtacaaggt
agcggtaaaaatggtcgcgttgtccgtgaagacatcgataacttcgatggctcagctgcc
gcagcaccagccgctgaagccccagctcaagcagaaaaagctggtaaacctgctaaagaa
aaagcagccttcaagtcttcagctgactacgctgaaatggaagaacgcatcccaatgact
cctatgcgtaaagccatctctaaagccatggaaacttcagcttataccgcaccacaagtt
accttgttcaagaatgtggaagtttctaaactttgggatcaccgcaagaaattcaagggt
gtggctgctgaacgcgatactaagctaaccttcttaccatatgtggttaaagctttagta
gcagctgttaagaaatatcctgcccttaacgcttctgttgacgatgctaaccaagagttc
gttcacaagaactactacaatgttggtatcgcaactgacactgaccaaggtctattcgta
ccaaacattaaagatgcagataagaaatcaatgtttgacattgctgatgaaatcactgaa
aaagctggcaaagcccatgctggtgaattatctgccggtgaaatgcgtgatggtacagta
actatctctaatatcggttctgttggcggtgagttcttcacgccaatcttgaactatcca
gaagttgctatccttggcgttggtacaatcaagcaagaaccaatcgttaatgaagacggc
gagatcacagttggtcgtgttacgaaactttcattagtatttgaccaccgtatcgttgac
ggtgcaacaggccaacaagcccttaatgaaattgcgcgtctattagctgatccagaatta
ttattaatggaaggatga

DBGET integrated database retrieval system