KEGG   Aerococcus urinaehominis: AWM75_04430Help
Entry
AWM75_04430       CDS       T04284                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
auh  Aerococcus urinaehominis
Pathway
auh00500  Starch and sucrose metabolism
auh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:auh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AWM75_04430
Enzymes [BR:auh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AWM75_04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AMB99293
UniProt: A0A120IAV9
LinkDB All DBs
Position
complement(977322..978779)
Genome map
AA seq 485 aa AA seqDB search
MTNGTLIQYFEFDLPDDGKHWQNTAEDAKHLADIGFSHIWLPPATKGTGTNDTGYGVYDL
YDLGEFDQKGAQRTKYGTKEEYLNAIKALQEQGISVLADVVLNHRMGADELEKFPAYEMD
PNDRNKVIEEAHEIEAWTHFTFPGRQGKYSDFEWRWYHFSGVDYDQSRDKSGIYMVAGEG
KGWADNENVDNEKANYDYLMGADVDYDREDTVEEIKKWTKWFLETTGVDGFRFDAVKHID
DGFIESIAKVASEVNEDFYAIGEYWKYHYHDLENYLKDTDYQLDLFDVMLHFHFKEASEA
GANYDMAKLLDNTLLTLKPQQAVTFVDNHDTQLGQSLASWVQPWFKPIAYGIILMHKEGL
PCVFYGDYYGLSQVDEENGYQADIDKMMTLRTERAYGDQEDYFDHGNCVGFSRLGDADHP
DGLALLCSNGDAGFKKMYVGQDKAGQVWIDYLAYSDQEVTIDDSGYGEFSCPAGGISIWT
QNNLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgggacactaatccaatattttgaatttgacttacctgatgatggcaagcat
tggcaaaatacggccgaagatgctaaacacctggccgatattggctttagtcatatttgg
ctgcctccagctactaagggaacggggaccaacgatactggttatggagtctatgacctt
tatgatttgggtgaatttgatcagaagggggctcagcgaaccaagtatgggactaaagaa
gagtatttaaatgctattaaggccttacaagagcaagggatatccgtcttagctgatgtg
gtgctcaaccaccggatgggggccgatgagctggagaagtttccagcctatgaaatggac
cccaatgaccgcaacaaggtaatcgaagaagctcatgaaatagaagcttggacccacttt
accttcccgggtcgccaaggcaaatattctgatttcgaatggcgctggtatcacttttca
ggtgttgattacgatcagtctcgtgataaatcgggcatctatatggtggctggtgaaggc
aagggctgggctgataatgaaaatgttgacaatgaaaaggctaattatgattacttgatg
ggagctgatgttgactacgatcgtgaagatactgtcgaagaaatcaaaaaatggaccaag
tggtttttagagacaacgggtgttgatggtttccgttttgatgctgttaagcatattgat
gatggttttatcgaaagtattgccaaggtggcaagcgaggtcaatgaggacttttatgcg
attggtgaatactggaaataccactaccacgatctagaaaactatctcaaagatacagac
taccagctagatctttttgatgtcatgctccacttccactttaaggaagcctcagaggcg
ggggctaattacgatatggccaagctgctcgataatacgcttttaacactcaagccccaa
caagctgtaaccttcgtcgataatcatgatacccagcttggtcagtccctggcttcttgg
gtacaaccctggtttaagccaattgcatatggtattattttgatgcataaggaagggcta
ccatgtgttttttatggtgattattacggtctaagtcaggtagatgaagaaaatggctac
caagctgacattgataagatgatgaccctacggactgagcgggcttatggcgaccaggag
gactactttgaccacggtaattgtgtgggctttagtcgcttgggtgatgctgaccatcct
gatggtctagccctcctttgctccaatggtgatgcaggttttaagaaaatgtatgtgggt
caagataaggccggtcaagtctggatagactacttggcttatagcgaccaggaagtgacg
attgatgatagtggctacggtgaattttcctgcccagctggtggcatctctatctggacc
caaaacaatttaaaataa

DBGET integrated database retrieval system