KEGG   Auritidibacter sp. NML130574: DCC27_006125Help
Entry
DCC27_006125      CDS       T05590                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
aul  Auritidibacter sp. NML130574
Brite
KEGG Orthology (KO) [BR:aul00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aul02000]
    DCC27_006125
Transporters [BR:aul02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    DCC27_006125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N KdpD AAA_29 MeaB AAA_30 BCA_ABC_TP_C SbcCD_C IstB_IS21 AAA_23 MukB Ribosomal_L50
Motif
Other DBs
NCBI-ProteinID: AXR73946
LinkDB All DBs
Position
1345704..1346441
Genome map
AA seq 245 aa AA seqDB search
MTEPAILVEHIRKTFKSTVAVDDVSLTVAPGEVVGLLGANGAGKSTTVDMIAGLQAPDAG
RARVLGRDPRRDKEVRQLLGVQLQEVRLHEALTVQELIDLYRSFYLRPRPAQELLDMVQL
DSKRNTRFSALSGGQQQRLSIALALVGQPQVVILDELTTGLDPAARRRIWKVVESLTDEA
ILLVSHAMDEVERLCDRVVLLDAGRVIAEGTPEQVVQRAEVSNLEEAFVALTGKEMTTAT
EEGEE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccagcaatccttgtggaacacattcgcaagactttcaagagcactgttgcc
gtcgacgacgtctcactcactgtggctccgggcgaggtggtgggcctactcggtgccaac
ggcgcgggtaagagcacgacggtagacatgatcgccggcttgcaggccccggatgcgggg
agggcccgtgtgctgggtcgggacccgcgtcgggacaaggaggtccgtcagctcctaggc
gtccagctacaggaggtacgtctccacgaggccttgaccgtccaggaacttattgacctc
tatcgcagcttctacctgcgtccccggcccgctcaggagctgctggacatggtgcagctc
gactcgaagcgcaacactcgcttcagcgctctgtccggaggccagcaacagcgcctttcc
atcgctctggccctcgtaggccagccgcaagtcgtgattctagatgaactaaccactggg
ctcgaccccgctgcacggcggcgcatttggaaggttgttgaatctctgacagatgaagca
atcctcctggtcagccatgcaatggacgaggtggagcgactgtgcgatcgggtcgttttg
ctcgacgccgggcgcgtgatagctgaagggacgcccgaacaagtcgtccaacgcgcggaa
gtgtcgaatctggaagaggcattcgtggccctgacaggtaaagaaatgacgactgcgacc
gaggagggcgaggaataa

DBGET integrated database retrieval system