KEGG   Aurantimicrobium sp. MWH-Mo1: AURMO_00558Help
Entry
AURMO_00558       CDS       T05480                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
aum  Aurantimicrobium sp. MWH-Mo1
Pathway
aum02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aum00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AURMO_00558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aum02000]
    AURMO_00558
Transporters [BR:aum02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AURMO_00558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_16 AAA_22 Rad17 AAA NACHT AAA_33 IstB_IS21 AAA_29 AAA_30 AAA_21 T2SSE APS_kinase TIP49 AAA_18 NTPase_1 TsaE SMC_N MobB ATPase_2
Motif
Other DBs
NCBI-ProteinID: AWR21171
UniProt: A0A2Z3RXA7
LinkDB All DBs
Position
539168..540853
Genome map
AA seq 561 aa AA seqDB search
MSGVKEVLRLAQPPLSKFAPGVIFGIFSAGAAVSLLAVSSWLITRAGDMPPIMYLNMAIV
GVRFFALARASFRYVERLSSHDAAFRSLSTLRVAMYRRLVPLAPDGLARTRRGDLLSRLV
ADVDQLQDLPLRVIQPVVIALVVSLGSVIAVWMILPPAGFALLIALVFAGLVGTVLQSML
ASGSDRALAGVRAQLDDTVMDVVSRLDVLSAFGALDGRMKDVARADRELRDVQLRRAVSS
GAVAALLSLIAGLATLIALWISVPHLVFPADANETPGLGWGVFSGPYLAIVVLVPMAVFE
VFQTLPQALGVWRAVKTSATRVAEVTPETIPSEIPREHMSLPMANLGSFDSLELSGVSAS
WPGAGSPALHPLSFTLRAGECLLVEGHSGSGKTTLAHVLVRFLDHSGQYAINGVDVRSLS
VEQVRQYVGLVEQSPHMFSQSIRQNLLFAHPTANDQELMSALNRVGLSEWVTQRGGLDAQ
VGEKGALVSGGQAQRLGLARALLHDFPVLILDEPTANVDPGQADALMRDVLEASKSAHRA
VIVISHVPVPDTLVTSKLTLN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggtgaaggaagttctccgtttagctcaacctccgttgagtaaatttgcgcca
ggagttatttttggcattttctctgcaggagcagctgtctctttgctagccgtctcctct
tggttgatcactcgtgccggcgatatgcccccgattatgtatttgaatatggccattgtg
ggggttcgattctttgcgctcgctcgagcctcattcagatatgtagaacggctatcaagc
cacgatgctgcattccgctcactctcaacattgcgagtggcgatgtatcgccgattagtt
ccgttagcgcccgacgggttagcgagaactcgtcgtggagatcttctttcacgtctcgtg
gcagatgttgatcaactccaagatctcccgcttcgagttattcagcctgttgtgatcgca
ctagtggtgagcctaggaagcgtgattgcggtctggatgattttgccaccagctgggttc
gcactgctcatcgctctcgtcttcgccggtcttgtggggactgtgcttcaatcgatgctc
gcctcaggatcagaccgggcattagccggtgtgagagctcagctggatgacaccgtgatg
gatgtcgtgtcacgacttgatgtgctttcagcatttggggctttggatggtcgcatgaaa
gatgttgctcgagcagatcgtgagctcagagatgttcaacttcgtcgagcggtctcatcg
ggggctgtcgcggctttactttcgctgattgcgggtctggcaacactcattgctctgtgg
atcagcgttccacatcttgtatttcccgcagatgccaatgaaacaccgggtctgggctgg
ggtgtcttcagcggcccctatttagccatcgttgtgctagttccgatggccgtcttcgag
gttttccaaactttgcctcaagctttgggcgtctggcgagctgtgaaaaccagtgcaaca
cgagttgctgaggtgactccagaaacaattccttcagaaatcccacgcgaacacatgtca
ctgccgatggcaaacctgggaagctttgactcgctcgagttatctggtgtgtcggcgtcc
tggccaggggcaggctctccggcccttcatcccctctctttcactcttcgcgctggagaa
tgcttgctggtggaaggccacagcggttcgggaaagacgacgcttgcccacgtgctggtt
cgattccttgatcattctggccagtatgcgatcaacggtgttgatgttcgctcactctca
gtagaacaagtgcggcaatacgtgggattggttgaacaatcacctcacatgttctctcag
tccatccgtcaaaatttgctctttgcacaccccactgcgaatgaccaagaactcatgagc
gccttgaaccgtgtgggcttatcagagtgggttacccagcgtgggggattagacgcacag
gttggtgaaaagggagctttggtatctggtggccaagcgcagcgtctaggtttagcgcgc
gcactgctgcatgatttcccggttctcattttggacgagcccacagccaatgttgatcct
ggtcaagccgatgcactcatgcgggacgtgctagaggcaagtaaatcagctcaccgcgca
gtcattgtgatttctcacgttcctgtccccgacacattagtgacatcaaaactgactctg
aattag

DBGET integrated database retrieval system