KEGG   Aerococcus urinae CCUG36881: AWM73_00300Help
Entry
AWM73_00300       CDS       T04528                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00970  Aminoacyl-tRNA biosynthesis
aun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aun00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AWM73_00300 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aun03029]
    AWM73_00300 (gatA)
Enzymes [BR:aun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AWM73_00300 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AWM73_00300 (gatA)
Mitochondrial biogenesis [BR:aun03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AWM73_00300 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase VbhA
Motif
Other DBs
NCBI-ProteinID: AMB95042
UniProt: A0A0X8FD03
LinkDB All DBs
Position
64405..65856
Genome map
AA seq 483 aa AA seqDB search
MSRFDESIKGLNQQLVDGEITAVELVQATIDRIKELDETYKAFLTLDEEGALAAAKASDE
KGYSTDRPLQGIPIGIKDNIITEGIETTASSRILEGFVPVYQSAVVEALEAAGAITIGKL
NLDEFAMGSSTETSYFGPSKNPWDTSRVPGGSSGGSAAAVASGEVVASLGSDTGGSIRQP
AAYNGIVGMKPTYGRVSRWGLIAFGSSLDQIGPMTRTVEDNALVLNAIAGHDHRDSTTAD
IEVPDFTAQLGDSIEGLRIAVPEEFFTNGIEADVQDRVEKAIDQLESMGAIVEKVHFPLL
KYGIPVYYIVASSEASSNLQRFDGVRYGYRADDIQDLEDLYVRSRSEGFGDEVKMRIMLG
TFSLSSGYYDAYFKKAGKVRTMIRQEFEELFEKYDVVAGPVTTSTAFKFGEKSDDPIEMY
LADLLTVPVNLAGLPSISVPCGFDSDDLPIGLQLIGNYFDEATLYKTAYAYEQATDHHTK
HPE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatttgatgaaagcattaaaggcttaaaccaacaattggtcgatggagaaatc
actgccgttgaattggtacaggctaccattgaccgtattaaggaactcgatgaaacttac
aaggcctttcttaccctagatgaagaaggcgctcttgcagccgcaaaagcgagtgatgaa
aaagggtattctaccgaccgccccctacaagggattccaatcgggattaaggacaacatc
attactgaaggtattgaaacgaccgcttcttcccgcattttagaaggttttgtgccagtt
taccaatccgccgtggtggaagccttagaagccgctggcgccattactattggtaaatta
aacttggacgaattcgctatggggtcttctaccgaaacctcctactttggaccaagtaag
aacccttgggataccagccgggtaccaggtgggtcttccggtggatctgctgccgctgta
gcctctggtgaagtcgtcgcttccctaggttctgatactggtggatctatccgccaacca
gccgcctataacggtattgtggggatgaaaccaacttacggccgggtatcacgctggggc
ttaattgcctttggttcttccctagaccaaatcggtccaatgactagaaccgttgaagac
aacgccttggtccttaacgccattgctggccacgaccaccgtgactccaccacagccgac
attgaagtccctgacttcaccgcccaattaggtgacagtatcgaaggcttacggatcgct
gttcctgaagaattcttcaccaacgggatcgaagccgacgtccaagaccgggtcgaaaaa
gctattgaccaacttgaatccatgggagccattgtggaaaaagtccacttcccactctta
aaatacgggattccggtttactacattgtggcttcctcagaagcgtcttccaacttgcaa
cgttttgacggggtccgttatggctaccgcgctgacgatatccaagacttggaagacctc
tacgtacgtagccgctcagaaggtttcggtgacgaagtcaaaatgcggattatgttaggg
accttctccctatcttccggttactatgacgcttacttcaagaaagccggtaaggttcgt
accatgatccgtcaagaatttgaagaactctttgaaaaatatgatgttgttgctggtcca
gtcaccacctcgaccgccttcaaattcggtgaaaaatccgatgacccaatcgaaatgtac
ttagccgacctcttgaccgttcctgtgaacttggccggcctaccaagtatttcggtgcct
tgtggtttcgacagcgatgacttaccaatcggtttacaattaattggtaactacttcgat
gaagcgaccttgtacaagaccgcttatgcctacgaacaagcaaccgaccaccacactaaa
catccagagtag

DBGET integrated database retrieval system