KEGG   Aerococcus urinae CCUG36881: AWM73_04790Help
Entry
AWM73_04790       CDS       T04528                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00500  Starch and sucrose metabolism
aun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AWM73_04790
Enzymes [BR:aun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AWM73_04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AMB95866
UniProt: A0A0X8FEI3
LinkDB All DBs
Position
complement(1029986..1031461)
Genome map
AA seq 491 aa AA seqDB search
MNGTMIQYFEWELPDDGKHWQRLANDASHLAQQGFTHVWMPPACKATGTNDVGYGIYDLC
DLGEFDQKGSTRTKYGSKTDYLTAIQALKDQQISPLADVVLNHKAGADQTEVFQAYEVDP
NNRQRKISQAHDIEGWTKFTFPGRKGKYSDFTWNWSHFSGVDYDQAKDQKGIFMIKGLNK
GWSDNEDVDDENGNYDYLMYADIDYDNPEVRAEVLDWALWFIKETGVSGFRLDALKHIDD
DFIDSLCDKILNEFPNFYFIGEYWKGDYQSLENYLKETELNIDLFDVKLHQNFYAVSTSW
DQFDMSTILNDTLLENNPTLAISFVDNHDSQPGQSLESWVEDWFKPIAYALILLHENGLP
CVFYGDYYGIQGDQPIPNKRAMLDTLLDLRRDKAYGKQNNYFDHPNCVGFTRQGDQDHPS
GLAVLMSNGEAGYKEMDVGEEHAQEQWGLVFSSKDMDQSVVTISEKGLACFTCPAGGVAV
WSRYEEDEDSQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaccatgatacagtattttgaatgggaactccctgatgacggtaaacactgg
cagcgtctagctaatgatgctagtcatttagcccagcaaggatttacccatgtgtggatg
ccgccagcttgtaaggctaccgggacaaatgatgtgggctacggcatctatgacttatgt
gacctgggtgagtttgatcaaaagggcagtactcggactaaatatggtagtaaaactgat
tatttaacagctattcaagctttgaaagaccaacagattagtccattagctgatgtggtt
ttaaaccataaggctggggctgaccagacggaagtttttcaagcttatgaagttgatcca
aacaatcgccaaagaaaaattagtcaggctcacgacattgaaggctggaccaagttcact
ttcccaggacgtaaaggaaaatatagtgactttacctggaattggtcacatttttctggg
gtggattatgaccaggctaaggatcaaaagggcatatttatgattaagggccttaacaaa
ggttggtcggataatgaagatgtcgatgatgagaatggtaattatgactatttaatgtat
gcagatattgattatgataatcctgaagtgagagcagaagttctagactgggccttatgg
tttatcaaggaaaccggggttagcggctttcgtttggatgccttaaagcatattgatgat
gattttattgacagtctatgcgacaaaatacttaatgaatttcctaatttctactttatt
ggcgagtattggaagggtgattatcaaagtttagaaaattatttaaaggaaacggaactc
aatatcgatctcttcgatgttaagctccatcagaacttttatgctgtctctacgtcttgg
gatcaatttgatatgtcgactatcttgaatgatactttattagaaaacaatccaaccttg
gccatttcctttgtcgataatcacgattcccaacctggacagtctcttgaatcatgggtg
gaagattggttcaagccgatcgcttatgcgctcattctcctccacgaaaatggcttaccc
tgtgttttctatggcgactattatggtatccaaggagaccagcctatcccaaataagcga
gccatgttagataccttgttagacttacgtcgggataaagcctatggcaaacaaaataac
tattttgaccatcccaattgtgttggctttaccaggcagggagaccaagaccatcctagt
ggtttggctgtattgatgtctaacggggaggccggctataaggagatggatgtaggggaa
gaacatgcccaggagcagtggggactcgtcttttcatcaaaggatatggaccagtctgta
gttactatttctgaaaagggcctggcttgttttacctgtccagccggaggagtggctgtt
tggagcagatatgaagaagacgaagatagccaatga

DBGET integrated database retrieval system