KEGG   Aerococcus urinae CCUG36881: AWM73_07920Help
Entry
AWM73_07920       CDS       T04528                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00040  Pentose and glucuronate interconversions
aun00051  Fructose and mannose metabolism
aun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWM73_07920
   00051 Fructose and mannose metabolism
    AWM73_07920
Enzymes [BR:aun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AWM73_07920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N ApbA 2-Hacid_dh_C ThiF Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AMB96431
UniProt: A0A109REN5
LinkDB All DBs
Position
complement(1739315..1740367)
Genome map
AA seq 350 aa AA seqDB search
MKATQLNENQEFEYVEIDEPECQPGWVKVKVHATGVCGSDTHKIEFGWKYDLPAVMGHEI
AGEVVEVGEGVTRVKVGERVIVPPLIPDFSCQYCEQGLYGLCENYKMIGTHYIGGFAEKL
VAPETNILPIGEMDYEDAVLIEPFAVSMHSVMNMDVELGDTAVVLGIGAIGIFTIEALLL
AGCKNVIAVDINDDKLEVAKQYGASYGINSIKEDLEAKVKEYTNGLGADIVMECAGTPIT
QEQALVLAKKRGKVGYTGIGYRDVLLHERHFESIFRHELTLKGFWNSYSAPFPGKEWTNL
IAYINQGRVNLEGMITHRYPLNKVDEAFKMMLSREQTFNKVIILPQEEKN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaacacaattaaacgaaaatcaagaattcgaatatgttgaaatcgatgagcct
gaatgtcaaccgggttgggttaaagtaaaagtccatgctaccggggtttgtggctcagat
actcataaaattgaatttggctggaaatatgaccttcccgcagttatgggtcatgaaatt
gccggggaagttgttgaagttggagaaggagtcacccgagtaaaagttggtgaacgagta
atcgttcctccacttattccagatttttcctgtcagtattgtgaacaaggtctgtatggc
ttatgcgaaaactataaaatgattggaacacactatattggtggttttgctgaaaaatta
gtcgctcctgaaactaatattttacctattggtgagatggattatgaagatgcagtgctt
attgagcctttcgctgtttctatgcacagtgtcatgaacatggatgttgaattgggtgac
actgcagttgttctaggtattggtgctattggaatctttaccatcgaagccttactttta
gccggctgtaagaatgtcattgctgtagatattaatgatgataaattggaagttgctaaa
caatacggtgctagttatgggattaattctatcaaggaagatctcgaagctaaggtgaaa
gaatacaccaacggcttgggcgctgatattgtcatggaatgtgcgggtactccaattacc
caagaacaagccctcgttttagctaagaaacgcggtaaagtcggctatactggcattggt
taccgtgacgtactattacatgaacgtcattttgaaagcattttccgccatgaattaaca
ttaaaaggattttggaattcatactccgctcctttccctggaaaggaatggacgaattta
attgcttatataaaccaaggacgtgttaatttagaagggatgattactcaccgctatcca
ttaaataaagttgatgaagcctttaagatgatgttgtctcgtgaacaaacctttaacaaa
gtaataattttaccacaggaggagaaaaactaa

DBGET integrated database retrieval system