KEGG   Aerococcus urinae CCUG36881: AWM73_07985
Entry
AWM73_07985       CDS       T04528                                 

Definition
(GenBank) PTS mannose/fructose/sorbose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00051  Fructose and mannose metabolism
aun02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:aun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AWM73_07985
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AWM73_07985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aun02000]
    AWM73_07985
Transporters [BR:aun02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    AWM73_07985
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AMB96443
UniProt: A0A109RET8
LinkDB
Position
complement(1750526..1751347)
AA seq 273 aa
MTSIQMILLIILSGIVGMGAIVDESQIHRPLVVCTLVGLILGDLKTGLLLGGSLEMMSLG
WMNVGLAMAPDTAIASMISSILVIQTGNGIGEGIAIAVPLAAAGQALTIFVRTITTFFSH
QADKYALDGNTRGIDAMFYIGLFLQALRVLLPTALILLIDIEAVNQLLTSIPTFITEGLT
IGGGMVMVVGYAMIINMMDVPYLKPFFYIGFILAAFSEINLVGYGILGACLAAVFVYLKY
NPSSNHQLITESNDNNYIPGDLDDDLDDDLDID
NT seq 822 nt   +upstreamnt  +downstreamnt
atgacctctattcaaatgatattactcattattctatccggaatagttggtatgggagcg
atagttgatgagtctcaaatccatagaccgttggtagtttgtactttagttgggttaata
ttaggagatttgaaaacaggcttacttcttggtggtagtttagaaatgatgtcactaggt
tggatgaatgtaggcctagctatggccccagatacagctattgcttccatgatttcctct
atacttgttatacagacaggaaacggaattggagaaggtatagcaattgcagttcctcta
gctgctgctggtcaagctttaactatatttgtaagaacaattacaacattttttagtcac
caagcagataagtatgctttagacgggaataccagaggtattgatgcaatgttttacatt
gggcttttcctacaagcactccgtgttttacttccaactgctttaatcttgttaattgat
attgaagcagtaaatcaactattaacatcaatacctacttttataacagaaggtctaacc
attggtggtggtatggttatggttgtgggttatgcaatgattattaatatgatggacgtt
ccgtatttaaaacctttcttttatataggttttatattagcagcattttctgaaattaac
ttagtcggatacggtatattaggtgcatgtttggctgcagttttcgtttacttgaagtac
aatccgtctagtaatcatcaattgattactgaaagtaatgataataattatattccagga
gatttggatgatgacttagacgatgacctagatattgattag

DBGET integrated database retrieval system