KEGG   Aerococcus urinae CCUG36881: AWM73_08540Help
Entry
AWM73_08540       CDS       T04528                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aun  Aerococcus urinae CCUG36881
Pathway
aun00620  Pyruvate metabolism
aun00680  Methane metabolism
aun01100  Metabolic pathways
aun01120  Microbial metabolism in diverse environments
aun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aun00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWM73_08540
  Energy metabolism
   00680 Methane metabolism
    AWM73_08540
Enzymes [BR:aun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AWM73_08540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Med11 GCR ALIX_LYPXL_bnd
Motif
Other DBs
NCBI-ProteinID: AMB96550
UniProt: A0A120IA04
LinkDB All DBs
Position
1863245..1865956
Genome map
AA seq 903 aa AA seqDB search
MPVKKLEANITQSMVKEEVNVLKEILDETTHKIVGDQVFEKIQGLVDLSMKEDYKQLEKV
VAQLSNEEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSLTIDRVSQSD
QAKEILEQVNVVPVLTAHPTQVQRKTILELTNQLHQLLRKYHDVKAGVVNRDKWYTDLRR
YIEIIMQTDIIREKKLTVRNEITNVTAYYNNSLIRAITKLSRQYRHLAAQKGILLDQAKP
ITMGMWIGGDRDGNPYVTAETLMLSATTQSEVILNYYIDKVYKLYRNFSLSTTLVDISPA
MKALAAKSNDQSIYRENEPYRRAFHYIQAKLTQNLAEVKNGLKRDDQAATPSYQNAEAFK
ADLLIIKDSLLANGEDALLTGDFNELLEAIDIFGFFLATIDMRQDSSVNEACVAELLKSA
KIVDDYSSLSEEEKVKVLLKELLEDPRPLSSAHSEKSELLEKELKIFRTARFLKDQLGDQ
VIKQHIISHTESVSDMFELAIMLKEVGLVAPKQARVQIVPLFETIEDLENAQGIMEEFLS
YDLVKNWIKGNHGYQEVMLGYSDSNKDGGYLSSVWTLYKVQQELTQLGEDHGIKITFIHG
RGGTVGRGGGPSYEAVTSQPFGSIKDRIRLTEQGEIIENKYGNQDVAYYNLEMLVSAAIS
RIVPSPVANKTEVEDFYQDMDDIVHYSNGVYRHLVFDTPEFYDYFFEATPIKEVSSLNIG
SRPAARKTITEITGLRAIPWVFSWSQTRIMFPGWYGVGSAFKHFIDQEEGNLEKLQAMYQ
SWPFFHSLLSNVDMVLSKSNMNIAEQYAQLAENEAVRAVFTTIRDEWQLTKEVLLAIEKH
DDFLATNPSLRASLDYRLPYFNVLNYIQIELIKRLRHNELDEDYEKLIHTTINGIATGLR
NSG
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
gtgccagtcaaaaagttggaagccaatatcacccaatctatggtcaaggaagaagtcaat
gtcttaaaagaaattcttgacgaaaccacccataagatagtgggtgaccaagtctttgag
aagatccaaggcctggttgacctctccatgaaagaagactacaagcaactggaaaaggtt
gtcgcccagctcagcaacgaagaaatggtggtggtttcccgttatttttcgattttgccg
ctactgattaatatttccgaagatgtcgatttcgcttatgaaatcaactatcaaaataat
accaatcaagattatctgggcaaactctcgctgactattgatcgggtgagccaaagtgac
caggccaaggagatcttagaacaggtcaatgtggtgcctgtcctcaccgcccaccctacc
caggtccaacgcaagacgattctggaattgaccaaccaactccaccaactcctgcgcaag
taccatgacgtgaaggctggcgtggttaaccgcgacaaatggtataccgacctgcgccgc
tatattgaaattattatgcagacggatattatccgggaaaagaagctcaccgtccgtaat
gaaatcaccaatgtgaccgcctactataacaattccctgatccgagccattaccaagtta
agccggcaataccgccacttagcagctcaaaagggaatcctacttgaccaagccaaaccc
attaccatgggcatgtggattgggggcgaccgggatggtaacccttatgtgactgccgaa
accctgatgctttccgctaccacccaaagtgaagtcatcctcaactactatattgacaag
gtctataaactctaccgcaacttctccctgtccaccactctggtagacattagtcccgcc
atgaaagccctggccgctaagtccaatgaccagtcgatttaccgggagaacgaaccctac
cgacgggccttccattatatccaagccaagctcactcagaatttagcagaagtgaaaaac
ggcctgaaaagagacgaccaagccgccactccaagctaccaaaacgcggaagcatttaag
gccgacctcttaattatcaaggactccttactggctaatggggaagacgccctcttaacc
ggagatttcaatgaattactggaagccatcgacatttttggtttcttcctggctaccatc
gacatgcgccaagattctagcgtcaatgaagcctgtgtagcggaattgttgaagtcagct
aagattgtcgacgactattcatccctctcggaagaagaaaaagtcaaagtcctcctcaag
gaattgctggaagaccctagacccttgtcttctgcccatagtgagaaatccgaactctta
gaaaaagaattaaaaatctttagaaccgcccgtttcttaaaagaccaactgggcgaccaa
gtgatcaagcaacatatcatctcccatactgagagtgtctcagatatgttcgaactcgcc
atcatgctcaaagaagtcggcctagtggctcctaaacaagcccgggtccaaatcgtgccc
ctctttgagaccatcgaagacttggaaaacgcccaagggatcatggaagaattcctcagt
tatgacctggtcaaaaattggatcaaaggtaaccatggctaccaagaagtcatgctgggt
tactccgactccaacaaggacggcggctacctatcttccgtttggaccctttacaaggtc
caacaagaactgacccaactcggcgaagaccacgggattaagattacctttatccatggt
cggggcgggactgtcggccgtgggggcggtccttcctatgaagcggtcacttcccaaccc
tttggctctatcaaggaccggatccgtctgaccgaacaaggagaaattattgagaataag
tacggcaaccaagatgtagcctactataacctggaaatgttagtctcggccgccattagt
cgaattgtgccaagtccagtcgctaataagactgaggtggaagatttctaccaagatatg
gatgacattgtccactattccaatggggtttaccgccacttagtctttgatacgccggaa
ttctatgattatttctttgaagccacaccgattaaggaagtgtcaagtttgaacatcggg
tcgcgtcccgctgcccgtaaaaccatcacggaaatcaccggactccgggctattccttgg
gtcttctcctggtcccaaacccggatcatgttcccgggctggtacggggtcggttccgcc
ttcaagcactttatcgaccaagaggaaggcaacctggaaaaactccaagccatgtatcaa
agctggcctttcttccattccttactctctaatgtcgacatggtcttatccaagtccaac
atgaatatcgctgagcaatacgctcaattggcagagaatgaagcggtccgtgccgtcttc
accaccatccgcgatgaatggcaactcaccaaagaagttctcctagccattgaaaagcat
gacgacttcctggctaccaacccttccttaagggccagcctggactatcgtttaccttac
ttcaatgttttgaactacattcaaattgaattgatcaaacgcctccgtcataatgaattg
gatgaagactacgaaaaactcatccataccaccattaacgggattgccaccggtttacgt
aactccggttga

DBGET integrated database retrieval system