KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_0995Help
Entry
HMPREF9243_0995   CDS       T01447                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00500  Starch and sucrose metabolism
aur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9243_0995
Enzymes [BR:aur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HMPREF9243_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AEA00598
UniProt: F2I4N2
LinkDB All DBs
Position
1029580..1031055
Genome map
AA seq 491 aa AA seqDB search
MNGTMMQYFEWELPDDGKHWQRLASDASHLAKKGFSHVWMPPACKGTGRNDVGYGIYDLY
DLGEFDQKGSLRTKYGSKVDYLAAIQALKDQQISPLADVVLNHKAGADQTESFQAYEVDP
NNRQRKISQAHEIEGWTKFTFPGRKGKYSDFTWNWTHFSGVDYDQTKDQKGIFMIKGLNK
GWSNNEDVDDENGNYDYLMYADIDYDNPEVRAEVLDWALWFIKETGVSGFRLDALKHIDD
DFIDRLCDKILNEFPNFYFIGEYWKGDYQSLENYLKETELNIDLFDVKLHQNFYAASTSW
DHFDMSTILEDTLLKNNPTLAISFVDNHDSQPGQSLESWVEDWFKPIAYALILLHENGLP
CVFYGDYYGIQGDQPISNKRAMLDTLLDLRRDKAYGKQNNYFDHPNCVGFTRQGDQDHPS
GLAVLMSNGEGGYKEMNVGEEHAQEQWGLVFSSKDMDQSVVTISEKGLACFTCPAGGVAV
WSKYEEDEASE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaaccatgatgcagtattttgaatgggagcttcctgatgatgggaaacattgg
cagcgtctagctagtgatgctagtcatttggcaaaaaaaggctttagtcatgtgtggatg
ccaccagcatgtaagggaactggaaggaatgatgtaggttatggcatctatgacttatat
gatctgggagagtttgatcagaaaggaagcttgcggacgaaatacggtagtaaagtggat
tatttagctgccattcaagccttgaaagaccaacaaattagccccttagctgatgtggtt
ttaaatcataaagctggcgctgatcaaacagaaagcttccaagcctatgaagtagatcct
aacaatcgacaaagaaaaatcagtcaggctcatgaaattgagggctggaccaagtttacc
ttcccggggcgaaagggaaaatacagcgattttacctggaattggacccacttttcggga
gttgattatgaccaaactaaggatcaaaagggcatatttatgattaagggccttaacaaa
ggttggtcaaataatgaagatgtcgatgatgagaatggtaattatgactatttaatgtat
gcagatattgattatgataatcctgaagtgagagcagaagttctagactgggccttatgg
tttatcaaggaaactggggttagcggctttcgtttggatgccttaaagcatattgatgat
gattttattgacaggctttgcgacaaaatacttaatgaatttcctaatttctactttatt
ggcgagtattggaagggtgattatcaaagtttagaaaattatttaaaggaaacggaactc
aatatcgatctcttcgatgttaagctccatcagaacttttatgcagcatcaacttcttgg
gatcactttgatatgtctactattttggaagatacattattgaaaaataacccgaccttg
gccatctctttcgttgataaccacgattcccaaccgggacagtcccttgaatcttgggtg
gaagattggtttaagcctatagcctacgccctcattctcctacatgagaatggcttaccc
tgtgttttctatggcgattattacggtattcaaggagaccagcctatctcaaataagcga
gccatgttagataccttgttagacttacgtcgggataaagcctatggcaaacaaaataac
tattttgaccatcccaattgtgttggctttaccaggcagggagaccaagaccatcctagt
ggtttggctgtattaatgtctaacggggagggcggctataaggagatgaatgtaggggaa
gaacatgcccaggagcagtggggactcgtcttttcatcaaaggatatggatcagtctgta
gttactatttctgaaaagggcctggcttgttttacctgtccagccggaggagttgctgtt
tggagcaaatatgaagaagacgaagctagcgaatga

DBGET integrated database retrieval system