KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_1601Help
Entry
HMPREF9243_1601   CDS       T01447                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00010  Glycolysis / Gluconeogenesis
aur00020  Citrate cycle (TCA cycle)
aur00620  Pyruvate metabolism
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01120  Microbial metabolism in diverse environments
aur01130  Biosynthesis of antibiotics
aur01200  Carbon metabolism
Module
aur_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9243_1601
   00020 Citrate cycle (TCA cycle)
    HMPREF9243_1601
   00620 Pyruvate metabolism
    HMPREF9243_1601
Enzymes [BR:aur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HMPREF9243_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEA01494
UniProt: F2I6N1
LinkDB All DBs
Position
complement(1609450..1611075)
Genome map
AA seq 541 aa AA seqDB search
MTYTFNMPDVGEGMSEGEVVSWHVAVGDSVQEEDVLVEIQNDKSVEEIASPVSGKIEKLY
VEEGDVAIVGEPLIDFSGEGLPESDNTASEAPASEEASAPSANASTGYYQFRLPDVGEGM
AEGEIAEWLVSEGDEVTEDTAVVEIQNDKSVEEVYAPVAGTIKNIIVPAGEVANVGDVLA
EIDSPEHNSEGSAPSSTPASPAQLEKADEGNEGATGAANGNGGVPQTADPNKRVLAMPSV
RQYAREKGVDISQVAGTGKNGRVLKEDIDNFDGQAASASAPAAEATSAKASEEPAKKAAP
KKESHEDGDVEHVKMTPMRKAIAKSMETSKYTAPQVTLFKDVEVSKLWDHRKKFKGIAAE
RDTKLTFLPYAVKALIAAVKKYPMLNASVDDDAQEFLLKKYYNIGIATDTDQGLYVPVVH
NADRKSMFDIADEINDKAAKAHEGKLKAADMSDGTVSISNIGSVGGEYFTPILNYPEVAI
LGFGAIVQQPVVDDNGELAVGRVLKLSLTFDHRIVDGATGQKALNEVGRLLSDPELLLME
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacatatacttttaatatgccagacgtcggtgaaggcatgagcgaaggcgaagttgtt
agctggcacgttgctgtcggagactccgtccaagaagaagatgttcttgttgaaatccaa
aatgataaatctgttgaagaaatcgcttcacctgtaagcggtaaaattgaaaaattatac
gttgaggaaggtgacgtagctatcgttggggaacctttgattgacttctcaggggaaggt
ttaccagaaagtgataatacagcttctgaagctccagctagtgaagaagcctcagctcct
tcagctaatgcaagtaccggatattaccaattccgcctaccagatgttggtgaaggaatg
gccgaaggtgagatcgctgaatggctagtcagtgaaggcgacgaagtcactgaagatact
gcggttgttgaaattcaaaatgacaaatccgttgaagaagtatacgcacccgttgctggt
accattaagaacatcattgtgcctgccggtgaagtagccaatgtgggtgatgttcttgct
gaaatcgactcaccagaacataacagcgaaggctcagcaccatcttcaactccagcttct
ccagctcaacttgaaaaagctgacgaaggcaatgaaggagcaaccggtgcagctaatggc
aacggtggcgttccacaaaccgctgatccaaacaaacgtgtattagcaatgccttccgtg
cgtcaatatgcgcgtgaaaaaggtgttgacatctctcaagttgcaggtaccggtaagaat
ggccgtgttctcaaagaagacattgataactttgacggacaagctgcaagcgcaagtgct
ccagctgctgaagcaacaagtgctaaagccagcgaagaacctgctaagaaagctgcacct
aagaaggaaagccatgaagacggcgatgtagaacacgtgaagatgactccaatgcgtaaa
gctatcgctaaatccatggaaacctctaaatacactgctcctcaagtgaccttgttcaag
gatgtggaagtatccaagctatgggatcaccgtaagaaattcaagggtattgctgctgaa
cgtgataccaagttaaccttcttaccatatgcagtgaaagctttaattgctgcagttaag
aaatacccaatgcttaacgcttcagttgatgatgacgcccaagaattcttattgaagaaa
tattacaacattggtattgctactgatactgatcaaggattatacgttcctgtagttcat
aatgcagaccgcaaatccatgtttgatattgctgatgaaattaatgataaagctgccaag
gcccatgaaggtaaattgaaggctgctgacatgtcagacggtactgtttcaatttctaac
atcggttcagttggcggggaatacttcaccccaattcttaactacccagaggttgccatt
ttaggctttggtgcaattgtgcaacaacctgtagttgacgataatggtgaattagcagtt
ggtcgagtattgaaactttcattaacattcgaccaccgtatcgtcgacggcgcaacagga
caaaaagccttgaacgaagttggtcgtctgcttagcgatcctgaattattattaatggaa
tcttaa

DBGET integrated database retrieval system