KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_1914Help
Entry
HMPREF9243_1914   CDS       T01447                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 TetR_C_27 HAD_2 HTH_24 TP6A_N HTH_7 HTH_AraC HTH_20 HTH_10
Motif
Other DBs
NCBI-ProteinID: AEA01272
UniProt: F2I895
LinkDB All DBs
Position
1926409..1927002
Genome map
AA seq 197 aa AA seqDB search
MTKKEDILKVARKLFQEQGLSKTSTNDIAHAVGISRGTLYYHFESKEALINALVDWISQE
IFQVARDLSKNTEWPPEERFIRVLTSLNVETSKDDDLLKNLNHPDNLLLHVKVQQAMLRE
IPPILAAIVEDGNKTGVFQADYPLEAMETLVAYVVCVIDEDEVQADPLLVQRKIQSLIKH
TELMLGAKEGLFQSYLN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaagaagacattctcaaagtagctcgaaagctgtttcaagagcaaggcttg
agtaagacttccaccaatgatatcgcccatgctgtgggaatttctcggggaacgctctat
taccacttcgaatccaaagaagcactcattaatgccctagtcgattggattagccaagaa
atttttcaagtcgctagagacctatcaaaaaatacagaatggcctcctgaagagcgtttt
attcgagtgcttaccagcttgaacgtggaaacgagtaaagatgacgacttattaaaaaat
ttgaatcaccccgataatcttttactccatgtcaaggtccaacaagccatgcttcgggaa
attcctcccattctagctgctatagtagaagacggtaataaaacaggcgtctttcaggca
gattatcccttagaagccatggaaaccttagttgcttatgtcgtttgtgtcattgatgaa
gacgaagttcaagcagatccattactcgttcagcgtaaaattcaaagtcttattaagcat
acggaactcatgctaggagcaaaggaaggcctgtttcaaagctatctcaattag

DBGET integrated database retrieval system