KEGG   Trichormus variabilis: Ava_0963Help
Entry
Ava_0963          CDS       T00277                                 

Definition
(GenBank) Manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ava  Trichormus variabilis
Brite
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ava_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: ABA20587
CyanoBase: Ava_0963
CYORF: Ava_0963
UniProt: Q3MEJ9
LinkDB All DBs
Position
complement(1164142..1164744)
Genome map
AA seq 200 aa AA seqDB search
MAFVQEPLPYDFNALEQYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI
AFKDPSKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGEFAAKINQDFGSFDKFKEEFSNA
AATQFGSGWAWLIDDNGTLKVTKTPNAENPLAHGQKALLTLDVWEHAYYIDFRNARPAFI
KNYLDNLVNWDFAAANYAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaggaaccactaccctacgactttaatgctttagagcagtatggcatg
aaaggtgagaccttcgagtatcactacggcaaacatcacaaagcttatgtagataacctg
aacaagcttaccgatggtacagaattggctgataagtccttagaagaagtcatccaaatt
gcctttaaggatccctctaaagctggaatctttaacaacgctgctcaagtgtggaaccac
actttcttctggaattctttaaagcccgcaggtggtggcgcacctacaggtgaatttgca
gccaaaatcaaccaagactttggtagcttcgacaaattcaaagaagaattttccaacgct
gctgcaactcagttcggtagcggatgggcttggctaattgatgataacggtacactgaaa
gtcactaaaactccaaacgccgaaaatcccctggctcatggacaaaaagcactcttaacc
ttggatgtttgggaacacgcttactacatcgacttcagaaatgctcgcccagcttttatc
aagaactacttagataacttggttaactgggactttgctgctgcgaattatgctaaagct
tag

DBGET integrated database retrieval system