KEGG   Trichormus variabilis: Ava_1554Help
Entry
Ava_1554          CDS       T00277                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ava  Trichormus variabilis
Pathway
ava00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ava_1554
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Ava_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABA21177
CyanoBase: Ava_1554
CYORF: Ava_1554
UniProt: Q3MCV9
LinkDB All DBs
Position
complement(1908495..1909991)
Genome map
AA seq 498 aa AA seqDB search
MKTPLNCQNYINGQWLNAATETTLNSHNPANKSEIVATFPRSQADDTDRAVTAARQAYGS
WRKVPAPARAEYIFRVGELLLQHKEELAQLISREMGKPITEARGDVQEGVDCAFYSAGEG
RRLFGQTTPSEMPNKFAMTVRMPIGVCALITPWNFPVAIPCWKAMPALVCGNTVILKPAE
DTPACATKLIEIFAAAGLPPGVINLVHGVGEEAGKALVEHPNIDLVSFTGSSATGAYVGE
TCGRTHKRVCLEMGGKNAQVVMEDADLELALDGALWGAFGTTGQRCTATSRLILHRDIKE
KFTTMLRERTSQLRLGAGTEPETDIGPIINNRQLQRVHEYMNIAREEGAKILIGGEIVTE
GQLKQGYFFQPTILDNVTPQMRVAREEIFGPVVALIEVSTFEEAIAILNDTKYGLSSSVY
TRDINRAFVAMRDIEVGITYINGPTIGAEVHLPFGGVKQTGNGHREAGTTALDVFTEWKS
VYVDFSGSLQRAQIDNRS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcccctaaactgccaaaattacatcaatggtcaatggttaaacgccgccaca
gaaaccaccctcaacagtcacaaccctgctaacaagagcgaaattgttgctactttcccc
cgttctcaagctgacgatacagatagagccgtcaccgccgcccgtcaagcctatggcagt
tggcgcaaagtcccagccccagccagagccgaatatatctttcgcgtcggtgaattatta
ctccaacataaagaagaactagcccaattaattagtcgggaaatgggtaaacccataact
gaagctaggggcgatgtgcaggaaggtgttgactgtgcattttatagcgctggtgaagga
cggcgactgtttgggcaaaccacaccatccgaaatgcccaacaaattcgccatgacagtg
cgaatgcccatcggagtttgtgctttaattactccctggaacttccccgtagccattcct
tgctggaaagcaatgccagctttggtttgtggtaatacggtgattctcaaacctgcggaa
gacacccccgcctgtgccacaaaattaattgagattttcgccgccgcaggtttaccaccg
ggtgtaattaacttggtgcatggagtcggggaagaagcagggaaagctttagtcgaacat
ccaaatattgatttagtttcatttactggttcttccgccactggtgcctatgttggtgag
acttgtgggcgcactcacaagcgcgtctgtttggagatgggtgggaaaaatgcccaagtg
gtgatggaagatgcagatttagaacttgcccttgatggggcattgtggggagccttcggc
acaacaggacaacgatgtacagctaccagtcgcttaattttacatcgtgatatcaaagaa
aaatttacaaccatgctgcgtgaacgcaccagccaactacgcttgggtgctggtacagaa
cctgagacagatatcggcccgataatcaataaccgacagttgcaacgggtacatgaatat
atgaatattgcccgtgaagaaggggccaagattttaatcggtggggaaattgtcaccgag
ggacaattaaaacagggttacttttttcaaccaacaattttagataatgtcaccccacag
atgcgtgttgcccgtgaagagatattcgggccagtagtagcattgattgaggttagcacc
tttgaagaagcgatcgctatccttaacgataccaaatacggtctttcctcctcagtctac
acccgtgacatcaatcgcgcctttgttgccatgcgcgacattgaagtcggtatcacctac
atcaacggccccaccattggcgcagaagtacacctgccttttggtggtgtcaaacaaacc
ggtaacggacaccgggaagcaggcaccaccgctttagatgtgttcacagaatggaaaagc
gtttacgtagacttttccggcagtttacaacgcgcgcaaattgataacaggagttag

DBGET integrated database retrieval system