KEGG   Trichormus variabilis: Ava_2996Help
Entry
Ava_2996          CDS       T00277                                 

Definition
(GenBank) Alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ava  Trichormus variabilis
Pathway
ava00500  Starch and sucrose metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ava_2996
Enzymes [BR:ava01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Ava_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABA22606
CyanoBase: Ava_2996
CYORF: Ava_2996
UniProt: Q3M8T0
LinkDB All DBs
Position
complement(3715069..3717633)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPPRLEPLRRLAYNLHWDWNVETKDLFRRLDPDLWESSHHNPVLMLGT
ISQGRLWEVVEDEGFLAQLDRANRQLDDYLQERSWYHKQRGQQPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPINDFYNM
TLHLERNPDGSELQIAVDYPGRKVYARVWRVQVGTVPLYMLDTNIEPNNPYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYEVTAYHMNEGHAAFSALERIRLLIQEEGLSYAE
AKQVVSSSNIFTTHTPVPAGIDLFPPDKILYYLGYYADIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPITAITNGVHARSCVAKS
TQELYDRYLGPNWSSAPPDNQLWERMDAIPDEELWRNHERCRLDMILYVRDHLVKHLRDR
GASASEIFQAQEVLDPNVLTIGFARRFATYKRATLWMRDVERIKRILLGNKDRKVQFVIA
GKAHPKDIPGKELIREINHFIREQHLEKQIVFVPNYDIHISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYEDPNYQDEVEANALYDLL
EKEVVPLFYDHRDIDGLPRPWVAKMKDAIRLNCPFFNTARMVREYAQRAYFPASDRYHTL
TSDNYAPAKELADWKAKLSDHWFNIKIKDVDVSAGADIEVNQTVAVKAKVDLATLNNDDV
QVELYQGSIDANGDIVNAVPVVMDYQGQDTDGLSVYTANILYTTSGLQGLSLRVLPKHPH
LSTPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgattcgtacattcaatgtttctccttccttgccgccgcgacttgagccgttg
cggcgactggcgtataatttacactgggattggaacgttgagactaaagatttatttcgt
cgtttagacccagatttgtgggaatctagccaccacaatcccgtactaatgctgggtaca
atcagtcaaggacggctttgggaagtcgtggaagatgaaggcttcctggcacagttggat
cgtgctaaccgtcaattagatgattatttacaagagcgcagttggtatcacaaacaacgc
ggtcaacagccaaaagaatgttacgcctatttttcggctgaatttgggctggttgattgt
ctacccgtttattctggtggtttgggtgttctggcaggggatcacctgaaatcagccagt
gatttaggtctacccttagttggtgtgggtttactataccagcaaggttactttgctcag
tatctcaatgccgatggctggcagcaagaacgttacccgattaacgatttctacaacatg
accttgcacctggaacgcaatcctgatggttcagaattgcagattgcggtggattacccc
ggacgcaaggtatatgccagagtttggcgggtacaggtgggaacagtacccctgtatatg
ctagacacgaatattgagccgaataacccctacgaccacgacatcacagaccaactctac
ggtggtgatatcgatatgcgtatccaccaagaaattatgttgggtattggtggtgtgcag
atgttgaaggctttgggttatgaagtcacggcttaccacatgaatgaaggtcacgccgcc
ttctcagccctagaacgtatccgcttgttaattcaagaagagggtttgagttatgcggaa
gctaaacaggtggtgagttcgagtaacatctttaccacgcatacaccagtaccggcagga
atcgacttatttcctccggacaagattctgtattaccttggttattatgcagacatcttt
ggcttacctaaagagcaatttttagggttggggcgagaaaacacaggtgatttatctggg
ccgtttagtatggcggtgctggcgttgaagatggcaacattttctaatggtgtagcccag
ttacacggtgtggtgtcccggcaaatgttccaaggtttgtggaaaaaggttcctgttgag
gaagtacccattacagcgattaccaacggtgttcacgcccgtagttgcgttgccaaatca
actcaggaattatacgatcgctacttggggccaaattggtcatcagcaccaccagacaac
caattgtgggaacggatggatgcaattcctgatgaggagttgtggcgaaatcacgaacga
tgtcgcttggacatgatactgtatgtgcgcgaccatttggttaaacacctgcgcgatcgc
ggtgcttctgcttccgaaattttccaagcccaggaagttctagaccccaacgtattaact
attggctttgcccgtcgttttgccacctataaacgcgctactctgtggatgcgggatgtg
gaaaggattaaacgcatcttattaggcaacaaagaccgcaaagtacaatttgtcatcgcg
ggtaaagcccaccctaaagacattcctggaaaagaactcatccgcgaaattaatcacttt
atccgcgaacaacacctagaaaaacaaatagtgtttgttcccaactacgacattcatatt
tcccggttgatggttgcgggttgcgatatttggttaaacacaccccgtcgtcccagagaa
gcatctggtactagtgggatgaaagcagccatgaatggcttacctaacctgagtgtgtta
gatggttggtgggatgaagccgattacgtccgcacaggctgggcgattggacatggggaa
aattacgaagaccccaactaccaggatgaagtagaagccaatgctctctatgatttactg
gaaaaagaagtcgtacccttattttacgaccaccgcgatatcgatggtttacccagacct
tgggttgccaaaatgaaagacgctatccggttgaactgtcccttctttaatacagcgcgg
atggttagggaatatgcacaacgggcttatttcccagccagcgatcgctatcacacttta
acatctgataattatgccccagctaaggaattagcagattggaaagccaaacttagtgac
cattggtttaatatcaaaatcaaagatgtcgatgtatccgcaggcgcagatattgaagtt
aatcaaaccgttgctgtcaaagccaaagtagacttggcaacattaaataatgatgatgtg
caagtggagctatatcaaggttccattgatgccaatggtgatattgtcaacgctgtgcct
gtagttatggattaccaaggacaggatactgatggtttaagtgtttatacggctaatatc
ctttacaccacctctggtttacaaggcttatccttgcgcgtattgccaaaacacccacat
ttatctactccttatgaacccaggttaatcgcttgggccgagtaa

DBGET integrated database retrieval system