KEGG   Trichormus variabilis: Ava_3176
Entry
Ava_3176          CDS       T00277                                 

Definition
(GenBank) Biotin/lipoyl attachment
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00020  Citrate cycle (TCA cycle)
ava00620  Pyruvate metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01200  Carbon metabolism
Module
ava_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_3176
   00020 Citrate cycle (TCA cycle)
    Ava_3176
   00620 Pyruvate metabolism
    Ava_3176
Enzymes [BR:ava01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ava_3176
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Other DBs
NCBI-ProteinID: ABA22784
CyanoBase: Ava_3176
CYORF: Ava_3176
UniProt: Q3M8A2
LinkDB
Position
3943406..3944704
AA seq 432 aa
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVEAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGGAAATPSAPPEPVAATAAVGVPAASQ
NGSNHREGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVADDIEAAVGKVKQPATTPTA
PTPTFTPAPVPATRTPAPAPAPAPVAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGLVYHPDINIAVAVA
MDGGGLITPVLKNADKIDIYSLSRTWKSLVDKARSKQLQPDEYSGGNFTLSNLGMFGVDT
FDAILPPGQGSILAIGASRPQLVATGDGSFAIKQQMQVNITSDHRIIYGADAAAFLQDLA
KLIETDAQSLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggcgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaagcagatatggatgtagaaaccttctacgaagggtatctcgctcacatc
attgtagaagctggtgatagcgcacctgtaggagcagcgatcgcttacgtagccgaaacc
gaagcggaaatcgaggccgccaagtctttaggcagttctggtggcgctgcggccactcct
agcgcccctcctgaaccagtcgcagccaccgccgccgtaggtgtaccagccgcatcacaa
aatggctctaaccaccgtgaaggaaggcttgtagcttcaccccgcgcccgcaagttggca
aaagaactgaaagttgatttgaccagtctcaaaggtagtggcccctatggtcgcattgtg
gccgatgacatagaagctgctgttggtaaagtcaagcaaccagccactacaccgactgca
cccacacccacctttaccccagccccagtcccagcaaccaggactccagcaccagcacca
gcaccagcaccagtagcggccgcacctgggcaagtagtaccatttaataccctacaaaac
gctgtcattcgtaacatggtggcgagtctagatgtacccgtgttccgtgtgggttacacc
atcaccaccgatggcttagacaaactttacaaacaaattaaatccaaaggtgtaaccatg
acagcgctactggcgaaagctgtagcggtgacattacaaaaacaccctttattaaatgcc
agctattcagatcaaggtcttgtttaccatcctgacatcaatattgcggtagctgtagcg
atggatggtggcggtttaattacaccagtattaaaaaatgccgacaagatagatatttac
tctctatcacgcacctggaaatctctagtagacaaggccagaagcaaacaactacaacca
gatgaatacagtggtggtaactttaccctatcaaacttggggatgtttggtgtagataca
tttgatgccattttacccccaggacaaggttcaattttagcgatcggcgcatctcgtccc
caattggtagccacaggcgatggttcatttgctatcaaacaacaaatgcaggtaaatatt
acatctgatcaccggattatttacggtgctgatgctgccgcatttttacaagatttagcc
aagttaattgaaactgacgctcaatctttgacactgtaa

DBGET integrated database retrieval system