KEGG   Trichormus variabilis: Ava_3176Help
Entry
Ava_3176          CDS       T00277                                 

Definition
(GenBank) Biotin/lipoyl attachment
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00020  Citrate cycle (TCA cycle)
ava00620  Pyruvate metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
Module
ava_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_3176
   00020 Citrate cycle (TCA cycle)
    Ava_3176
   00620 Pyruvate metabolism
    Ava_3176
Enzymes [BR:ava01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ava_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABA22784
CyanoBase: Ava_3176
CYORF: Ava_3176
UniProt: Q3M8A2
LinkDB All DBs
Position
3943406..3944704
Genome map
AA seq 432 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVEAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGGAAATPSAPPEPVAATAAVGVPAASQ
NGSNHREGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVADDIEAAVGKVKQPATTPTA
PTPTFTPAPVPATRTPAPAPAPAPVAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGLVYHPDINIAVAVA
MDGGGLITPVLKNADKIDIYSLSRTWKSLVDKARSKQLQPDEYSGGNFTLSNLGMFGVDT
FDAILPPGQGSILAIGASRPQLVATGDGSFAIKQQMQVNITSDHRIIYGADAAAFLQDLA
KLIETDAQSLTL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggcgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaagcagatatggatgtagaaaccttctacgaagggtatctcgctcacatc
attgtagaagctggtgatagcgcacctgtaggagcagcgatcgcttacgtagccgaaacc
gaagcggaaatcgaggccgccaagtctttaggcagttctggtggcgctgcggccactcct
agcgcccctcctgaaccagtcgcagccaccgccgccgtaggtgtaccagccgcatcacaa
aatggctctaaccaccgtgaaggaaggcttgtagcttcaccccgcgcccgcaagttggca
aaagaactgaaagttgatttgaccagtctcaaaggtagtggcccctatggtcgcattgtg
gccgatgacatagaagctgctgttggtaaagtcaagcaaccagccactacaccgactgca
cccacacccacctttaccccagccccagtcccagcaaccaggactccagcaccagcacca
gcaccagcaccagtagcggccgcacctgggcaagtagtaccatttaataccctacaaaac
gctgtcattcgtaacatggtggcgagtctagatgtacccgtgttccgtgtgggttacacc
atcaccaccgatggcttagacaaactttacaaacaaattaaatccaaaggtgtaaccatg
acagcgctactggcgaaagctgtagcggtgacattacaaaaacaccctttattaaatgcc
agctattcagatcaaggtcttgtttaccatcctgacatcaatattgcggtagctgtagcg
atggatggtggcggtttaattacaccagtattaaaaaatgccgacaagatagatatttac
tctctatcacgcacctggaaatctctagtagacaaggccagaagcaaacaactacaacca
gatgaatacagtggtggtaactttaccctatcaaacttggggatgtttggtgtagataca
tttgatgccattttacccccaggacaaggttcaattttagcgatcggcgcatctcgtccc
caattggtagccacaggcgatggttcatttgctatcaaacaacaaatgcaggtaaatatt
acatctgatcaccggattatttacggtgctgatgctgccgcatttttacaagatttagcc
aagttaattgaaactgacgctcaatctttgacactgtaa

DBGET integrated database retrieval system