KEGG   Trichormus variabilis: Ava_3333Help
Entry
Ava_3333          CDS       T00277                                 

Definition
(GenBank) Inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ava  Trichormus variabilis
Pathway
ava00521  Streptomycin biosynthesis
ava00562  Inositol phosphate metabolism
ava01100  Metabolic pathways
ava01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Ava_3333
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ava_3333
Enzymes [BR:ava01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     Ava_3333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: ABA22940
CyanoBase: Ava_3333
CYORF: Ava_3333
UniProt: Q3M7U6
LinkDB All DBs
Position
4152590..4153396
Genome map
AA seq 268 aa AA seqDB search
MNDFWTTILDFAETTTTRVGARLMQDFGQVQALQKADGSLVTQADKWADQEIRDAIASTF
SGYGILTEESERTFPGTEWCWVIDPLDGTTNFTRGIPIWSISLALLYRGTPIFGYVYAPP
LNQAFHGFWPGTSGLSTPSGAFLNHHPIHTSSDAPSSNHFFNLCSRSLAVVQNGFPCKIR
MLGVASYNFLTVAAGATLGGIEATPKVWDIAGAWVIVQAAGGSWVSLDSEPFPLSNGEDY
SDRSFPTLVVSRSDLVTFFTPLIKDVKI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttttggacgacaattctcgattttgccgaaactaccaccaccagagtgggc
gcgcgattaatgcaggattttgggcaagtgcaggctttacaaaaagctgacggtagcttg
gtaacccaagctgataaatgggcagatcaagaaattcgagatgcgatcgcctctactttt
tctggttacggaattttaactgaagaaagcgaacgcacatttcctgggacagagtggtgc
tgggtcatcgatcctttagatgggacaacgaactttacacggggtattcccatctggtcg
atttctctggctttgctttaccgagggacaccgatttttggttatgtttatgcgccaccc
ctcaatcaagcttttcatggtttctggccaggtacatctggtttaagcacaccctctggg
gcatttctcaatcatcacccaattcataccagtagtgacgctcccagcagcaatcacttt
tttaacctttgttcccgcagtttagctgttgttcagaacggatttccctgcaaaattcgg
atgctgggtgtagctagttacaacttccttacggtggcggctggcgcaacattaggagga
atagaagcaacaccaaaagtttgggacatagcaggcgcttgggtaattgtccaagctgct
ggtggtagctgggtttccctcgactcagaaccatttcccttatcaaatggggaagattat
agcgatcgctctttccctactctcgttgttagtcgttcagacttagttacattttttaca
cctctaattaaagatgtaaaaatttaa

DBGET integrated database retrieval system