KEGG   Trichormus variabilis: Ava_3905Help
Entry
Ava_3905          CDS       T00277                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ava  Trichormus variabilis
Pathway
ava00630  Glyoxylate and dicarboxylate metabolism
ava00710  Carbon fixation in photosynthetic organisms
ava01100  Metabolic pathways
ava01120  Microbial metabolism in diverse environments
ava01200  Carbon metabolism
Module
ava_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ava_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ava_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ava_3905
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ava_3905
Enzymes [BR:ava01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ava_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Guanylate_cyc_2
Motif
Other DBs
NCBI-ProteinID: ABA23510
CyanoBase: Ava_3905
CYORF: Ava_3905
UniProt: Q3M676
LinkDB All DBs
Position
complement(4856590..4856919)
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDVQIEKQVQYILSQGYIPAVEFNEASEPTEFYWTLWKLPL
FGAKTSREVLGEVQACRSQYPGHYIRVVGFDNIKQCQVLSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttaccaaaagagcgtcgttacgaaaccctttcttacttaccccccctcacc
gacgttcaaatcgaaaagcaagtccagtacattttgagccaaggctacattccagccgtt
gagttcaacgaagcttctgaacctaccgaattttactggacactgtggaagctacctttg
ttcggcgctaaaacatctcgtgaagttttgggtgaagttcaagcttgccgttctcaatat
cctggtcactacatccgtgttgtaggatttgacaacatcaagcagtgccaagtcctcagc
ttcatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system