KEGG   Trichormus variabilis: Ava_3907Help
Entry
Ava_3907          CDS       T00277                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ava  Trichormus variabilis
Pathway
ava00630  Glyoxylate and dicarboxylate metabolism
ava00710  Carbon fixation in photosynthetic organisms
ava01100  Metabolic pathways
ava01120  Microbial metabolism in diverse environments
ava01200  Carbon metabolism
Module
ava_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ava_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ava_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ava_3907
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ava_3907
Enzymes [BR:ava01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ava_3907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABA23512
CyanoBase: Ava_3907
CYORF: Ava_3907
UniProt: Q3M674
LinkDB All DBs
Position
complement(4857469..4858899)
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQTKSGYKAGVQDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQFIAYIAYPLDLFEEGSITNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVSDAISKAQAETGEIKGHY
LNVTAPTCEEMLKRAEYAKELNQPIIMHDYLTAGFTANTTLARWCRDNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYVEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLAREGNDVIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagacaaaatctgggtataaagccggggttcaagat
tacagactaacttattacacacctgattacacacctaaagatacagatattctggcggcg
ttccgtgttacaccccagcccggagttccctttgaggaagcggctgcggctgtagcggct
gagtcttctactggtacttggacgaccgtatggacagacctgttaaccgatctagatcgt
tacaaaggtcgttgctacgatatcgaaccagtacctggcgaagacaaccaattcattgcc
tacatcgcttatcctttggatctgtttgaagaaggctccatcaccaacgttttaacctca
attgtaggtaacgtatttggttttaaagcattacgcgcattgcgtttggaagacattcgc
tttcctgttgcttacatcaaaactttccaaggccctcctcacggtatccaagttgagcgt
gacaaattaaacaaatatggtcgtcctttgttgggttgtaccatcaaaccaaaattaggt
ctgtctgctaagaactacggacgcgctgtatacgagtgtttgcgcggtggtttggacttc
accaaagacgacgaaaacatcaactctgcaccattccaaagatggcgcgatcgcttcctg
tttgtgtctgatgctatcagcaaagcacaagcagaaacaggcgaaatcaaaggtcactac
ctcaacgtgacagctcctacctgtgaagaaatgttgaagcgggctgagtacgctaaagaa
ctcaatcagcccatcatcatgcacgactacctaacagcaggtttcaccgctaacaccacc
ttggctcgttggtgtcgtgacaacggcgttctactgcacatccaccgcgcgatgcacgca
gtaatcgaccgtcaaaagaaccacggtatccacttccgtgtattagctaaagccctacgt
ctatctggtggtgaccacatccacaccggtaccgtagtaggtaaattggaaggtgaacgc
ggtatcacaatgggcttcgttgacctattgcgtgaaaactacgttgaacaagacaagtct
cgcggtatctactttacccaagactgggcttctttacctggtgtaatggcagttgcttcc
ggtggtatccacgtatggcatatgcccgcattggtagaaatcttcggtgatgactccgta
ctgcaatttggtggtggtacactcggacacccctggggtaacgctcctggtgcaaccgct
aaccgtgtagctttggaagcttgcgtccaagcgcgtaacgaaggtcgtaacttggctcgt
gaaggtaacgacgttatccgtgaagctgctaagtggtctcctgaattggctgtcgcttgc
gaactgtggaaagaaatcaagttcgagtttgaggcaatggataccgtctga

DBGET integrated database retrieval system