KEGG   Trichormus variabilis: Ava_4198Help
Entry
Ava_4198          CDS       T00277                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ava  Trichormus variabilis
Pathway
ava00500  Starch and sucrose metabolism
ava01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ava_4198
Enzymes [BR:ava01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Ava_4198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ABA23797
CyanoBase: Ava_4198
CYORF: Ava_4198
UniProt: Q3M5D9
LinkDB All DBs
Position
5257970..5260552
Genome map
AA seq 860 aa AA seqDB search
MMIFTLKIASLTFWKSIHLRLNFTHSKKQFIHMKRWLLANLIALCSFLFLGTNAAWAVGG
GIAPGAPGVSSVWSYAGKQGIGTSYEQYVDNKYSDRAPTNAISKVWFSIAQGIVTETAYG
EIDRAQINDLQFLVTGNGFFDEEKVSTTSKVDYLDKDKDGRPLSPAYRVINKDKDGKYTI
EKHIFTDPDHQTLFTKVIFTAKEDNVTPYILINPHMNNTGKEDVAFVKSDSLNAREGEIV
YLSLKSSLPFVKTSAGYVARSDGYQDLKDNGVMDWTYDYTDQSKPGSVAMIGQLPTLNKG
QTSTFNIAVGFGSTYQEATEQVDASLKEGYESLLAKYNGKGSAVGWEDYLASLKNLPAMI
ANTGDKGKQLYASAFTLKSMEDKENPGALIASLSVPWGDTVNADTFATGYRAVWPRDFYQ
AAMALLALGDKETPLTAFKYLPQVQVQSDTPGNAGATGWFLQKTHVDGTLEWLGVQLDQT
AMPIMLGWKLWKAGVLSDGEITEQYRTMLKPAAEFLANGGNVNIHTSDQANNRKINPPST
HQERWEEQSGYSPSTTAAIITGLVAAGDIAENAADDPLAAKYYFSKADEYQKNVDKFMFT
TTGDIKNCNSSSEYLLRVTPNADPNDGSRIHDNNSLLEADERQILDGGFLELVRYGVRKG
DDAHIAASVCALDNISLSEDLRVRYDIPFDGKKYPGFRRYGNDGYGEQINDGSNFRDIDD
GQKKLRRGRIWPFFTGERGHYELELAKAKNGGTISDQDVAKLRDTYVRAMEYFANESLML
PEQVWDGVGENKAHNYITGEGTNSATPLAWAHAEYIKLVKSLTDKNVWDSYPIVQARYQS
SESLTASSSHPNGTKISANP
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcttcactctcaaaattgcatcacttactttctggaagtctattcatctccgt
ctcaattttactcactcaaaaaaacaattcattcatatgaaacgttggttattagctaac
ttaattgctctttgctcgtttttgttcttaggaacaaacgctgcttgggcagtcggtggt
ggcattgcgccgggcgcaccgggtgtttcctctgtttggtcttatgctggtaagcaaggc
attggaacatcctatgaacagtatgtggataataaatatagcgatcgcgctcctacaaat
gccatctccaaggtttggttttcaattgctcaaggtattgtgacagaaaccgcctatgga
gaaatcgatcgcgcccagatcaatgacttacaattcttagtcacaggcaacggttttttt
gatgaagagaaggtttctaccaccagtaaggtggactatctagataaagataaggatgga
aggcctctttctcctgcttatcgtgtgatcaataaagataaagatggtaaatacaccatt
gaaaagcacatctttaccgatcctgatcaccaaactttgtttacaaaagtgatctttact
gccaaagaggataacgttaccccctacattctgattaatcctcacatgaataatactggc
aaagaagatgtagcttttgttaaaagcgatagtctcaatgctagggaaggagaaattgtt
tatctaagtttgaagagttcattgccttttgtgaaaacctcagccggatacgtagctcgt
agtgatggctatcaagatttaaaagacaatggggtgatggactggacttatgactacact
gatcagagcaagccggggagtgtagctatgataggtcaactgcctaccctcaataaagga
caaacttccacctttaacattgctgtaggctttggcagcacctatcaagaagcaaccgaa
caagtcgatgcttctttaaaagaagggtacgaaagtctgttagcaaaatacaacggtaaa
ggcagcgccgtaggctgggaagattatctagccagtcttaaaaatctacctgccatgatt
gccaacaccggtgacaagggtaaacagctttatgccagtgctttcaccctcaagagtatg
gaagataaagaaaatcctggggctttaattgcttctttatccgttccttggggagatact
gtgaacgcagacacatttgccacaggctatcgagcagtttggccgagagacttttatcaa
gcagctatggctttgttagctttaggagataaagaaactcccctaacggcttttaaatac
cttccacaagtgcaagtgcaatcagatacaccaggtaacgctggggctacaggctggttt
ttacaaaaaactcacgttgatggaaccttagaatggctgggagtgcagttagatcaaact
gccatgccgattatgttgggctggaaactttggaaagccggagtgttgtcggatggtgaa
atcactgagcaatatcgcacgatgttgaaacctgccgcagaatttctggctaatggcggt
aatgtcaatatacatacctctgatcaagcaaacaaccgcaagataaacccaccaagcact
catcaagaacgatgggaagaacaatcaggatattccccctctacaacggctgcgattatt
actgggttagttgcggcgggtgatattgctgaaaatgcagctgatgatcctcttgcagca
aaatattatttcagtaaagcagatgaatatcaaaagaatgtggataaatttatgtttacc
acaactggagatattaagaactgtaatagctccagtgaatatctcctgagagttacccct
aatgcagatcctaacgatggaagtcgcatccacgacaacaatagtttgctggaagcggat
gaacgccagattttagatggtggtttcttggaattggtacgttatggagtcagaaaggga
gatgatgctcacattgctgccagtgtttgcgccttggataatatcagcctctcagaagat
ttaagggtgaggtacgacataccttttgatgggaaaaagtatccaggattccgacgctat
ggcaatgatggctatggtgaacaaatcaacgatggtagtaactttcgggatattgacgat
ggccagaaaaaactccgcagaggtaggatttggccgttcttcactggtgagcgtggtcat
tatgaacttgagttagctaaggccaaaaatggaggcactattagcgatcaagatgttgct
aaactacgtgatacttatgtacgagcaatggaatattttgctaacgaaagtctcatgctt
cctgaacaagtatgggatggtgttggcgagaataaggctcataattacatcactggagaa
ggaacgaatagcgccacacctttagcttgggcgcacgccgaatatattaagttagtcaaa
tcattgactgataagaatgtttgggattcctaccccattgttcaggcaagataccaatct
tcggaatctcttactgcctcaagttctcatccgaacggcactaagatcagcgcaaatcct
taa

DBGET integrated database retrieval system