KEGG   Trichormus variabilis: Ava_5011Help
Entry
Ava_5011          CDS       T00277                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ava  Trichormus variabilis
Pathway
ava00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ava_5011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ava02000]
    Ava_5011
Enzymes [BR:ava01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ava_5011
Transporters [BR:ava02000]
 Other Transporters
  Pores ion channels [TC:1]
   Ava_5011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C GST_C_5 Glutaredoxin Tom37
Motif
Other DBs
NCBI-ProteinID: ABA24608
CyanoBase: Ava_5011
CYORF: Ava_5011
UniProt: Q3M328
LinkDB All DBs
Position
6298246..6298911
Genome map
AA seq 221 aa AA seqDB search
MAEIKIYSAVVCPYAHRSRLVLQEKGIDFDLIEINLQNKPEGFTDISPYGKVPALAHGNH
RVWESAVINEYLNEVFPQPPLLPSSPIAKAQARIWIDFANTRFVPAFSALLRSPDIQQQE
AAKQELYKHLEFIENEGLGKLSGDGPYWFGESISLVDFTFYPWFERWPALKHYRGLALPE
EFTRLRRWKKAVKQRDSVVAIANSKEFYIERYARFATPVAA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattaagatatacagtgcggtagtttgcccttatgctcaccgttcgcgtttg
gtacttcaagaaaaaggcattgactttgatttgatagagatcaatttgcagaacaagcca
gagggatttacagatatttctccttatggaaaagtaccagcgctagcacatggtaatcac
cgagtttgggaatcagcagtaattaacgaatatctgaatgaggtatttcctcagccgcct
cttttacctagtagtcctattgctaaagcccaggctcgtatctggattgattttgctaat
actagattcgttccggctttttctgctttgttgcgtagtcctgatattcaacagcaagaa
gcagctaaacaagaactgtataaacatttagagtttatcgaaaatgaaggtctagggaag
ttatcaggagacggcccctactggtttggtgaatcaattagtctggttgatttcaccttt
tatccctggtttgagcgttggcctgcactgaagcattatcgaggtttggcgctaccagag
gaatttactcgtctacgtcgctggaaaaaagctgtaaaacaacgtgattcagttgtggcg
atcgctaatagtaaggagttctacattgagcgatatgctagatttgctactcctgtcgct
gcatag

DBGET integrated database retrieval system