KEGG   Actinomyces viscosus: NCTC10951_02266
Entry
NCTC10951_02266   CDS       T06789                                 

Definition
(GenBank) Uncharacterised protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
avc  Actinomyces viscosus
Pathway
avc00620  Pyruvate metabolism
avc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC10951_02266
Enzymes [BR:avc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     NCTC10951_02266
SSDB
Other DBs
NCBI-ProteinID: VEI17579
UniProt: A0A3S4VYC5
LinkDB
Position
1:2653484..2656900
AA seq 1138 aa
MTTTDAATTSAIALRLELLGISAPAQVEQSEADRLMSPILARQRELSRRLAHRPCAADQR
IQTFLDSYLEGAAATPQLPRSTFVLDQPGLARALSLPADSTSFTSDYVESYKVLGGVLHN
PRNDRRTTAGVFHVAEGGLPIPDDKIAVPRDVFARLLAHAVEAPEDLLTLPWASRQEDPA
RCFVSLLLRPVVVPEVPGFSAERSMEIRFIAPGGLVSNLDFVEGIFGNGGDPYLPENDAS
LAPESWTGHTGCVILAPHLTTLTKKELGLPSWEEATERQRRDGQCWKDEDELYNDGKAFK
CVARDERGVIVTVIADNYFGYCKKEVKTQIGYSANLFGCVEEEHAGGAIAYPRYNLGQEY
TDIHTPEGLTLEHVVERNPGRFEMREDGSAVVVDDPTVVLVPAGAHYSMRNQTITWTRPD
GQEASIPLLVSNTYVAPNGYRVHAKHREGDATQWHLVGTAPWSTQAHKPATVSGGGKSEI
SKSLLDAFVFGEAYVGDVDEDFDTVQKILDGNYADRFVDPANKSDNHRSILSERRSLGSV
IKLLTPSSMYTDEYNAFLESIPAHIKELIFTVKRFYQPSWGKDWRSHFSVGIINGRKGNS
LRLDEELIKVNMLRVGFEDDGAWRLLSLRPDFSPAAKVQTEDDITASIVAPGGLVSTPDS
ELSRKFVTNCESLLFQRPDDAIVRGYDKQTESDMSDPDADLFISNFEPLTPEDARAMAAD
APGLSRFTQPMQDLVARAAALPEAEDPAEETYWVSTADPRLVGGTPTKNPRYLQVRPDIA
NPKDVALADLTNHLFHDVPLAEPLRHSVDVVAAGRRNNPPEDGVPPLCAYNPLHYMELPE
LFMEFISSMTGKSPSTTGAGSEGALTKSPFNALPAIYDLNAALLSYALSGYDGWLSSAGY
IGPKVQVAHDISLLIPEIFSRMSTEERDARSLIEGGYLERIEDFEYEGRTVQASRLGYRM
NQAFASTFFGRIFLHPDVVFTEEMLRPELQDEAVFADSVDIIVTTHKVVAEHYRADGSIE
WAVPPLRALLEIMIDGTSREGWDLTSPEFRALFERENILNSSWYAARLDAKVARDTRQAH
QAIEDLTRFYTAENNEEVIERLGIEGRLAEARAWLDKVSSPAYREHLVGTLGLQPTLA
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgacaactacagacgcggccaccacttccgccatcgccctgcgtttggagctgctgggg
atctccgccccggcacaggtcgagcagagtgaggcggaccgcctcatgtccccgatcctg
gcgcgccagcgcgagctctcccgccggctggctcaccgcccctgtgctgctgaccagcgc
attcaaaccttcctggactcctacctggagggcgcggccgccaccccgcagctgccgcgc
tcgaccttcgtcctggaccagcccggcctggctcgggccctgtccctgccggcggactcc
accagcttcacctccgactacgtcgagagctacaaggtgctcggcggcgtcctgcacaac
ccccgcaacgaccgccgcaccaccgccggcgtcttccacgtcgccgagggcggcctgccg
atccccgatgacaagatcgccgtcccacgcgacgtcttcgcccgcctcctggcccacgcc
gtcgaggcccccgaggacctgctgaccctgccgtgggcctccaggcaggaggacccggcc
cgctgcttcgtctccctgctgctgcgtcccgtcgtcgtgccggaggttcccggcttctcc
gccgagcgctccatggagatccgcttcattgcccccggcggcctggtctccaacctggac
ttcgtcgagggcatcttcggcaacggcggcgacccctacctgccggagaacgacgcctcc
ctggccccggagtcctggaccggccacaccggctgcgtcatcctcgccccgcacctgacc
accctgaccaagaaggagctgggcctgccctcctgggaggaggccaccgagcgccagcgc
cgcgacggccagtgctggaaggacgaggacgagctctacaacgacggcaaggccttcaag
tgcgtggcccgcgacgagcgcggcgtcatcgtcaccgtcatcgcggacaactacttcggc
tactgcaagaaggaggtcaagacccagatcgggtactcggccaacctcttcggctgcgtg
gaggaggagcacgccggcggcgcgatcgcgtacccgcgctacaacctgggccaggagtac
accgacatccacacgcccgagggcctgaccctcgagcacgtcgtcgagcgcaacccgggc
cgcttcgagatgcgcgaggacggctccgccgtcgtggtggacgacccgaccgtggtgctg
gtgcccgcaggcgcccactactcgatgcgcaaccagacgatcacctggacccgccccgac
ggccaggaggcctcgatcccgctgctggtgagcaacacctacgtggcccccaacggctat
cgggtccacgccaagcaccgcgagggcgacgccacccagtggcacctggtgggcaccgcc
ccctggtccacgcaggcccacaagcccgccaccgtctccggcggcggcaagtcggagatc
tccaagtccctcctggacgccttcgtcttcggcgaggcctacgtcggcgacgtcgacgag
gacttcgacaccgttcagaagatcctcgacggcaactacgccgaccgcttcgtcgacccg
gccaacaagagcgacaaccaccgctcgatcctctccgagcgccgctcgctgggaagcgtc
atcaagctgctgacgccctcgtcgatgtacaccgacgagtacaacgccttcctggagtcg
atcccggcccacatcaaggagctcatcttcaccgtcaagcgcttctaccagcccagctgg
ggcaaggactggcgcagccacttctccgtgggcatcatcaacggccgcaagggcaactcc
ctgcgcctggacgaggagctcatcaaggtcaacatgctgcgcgtgggcttcgaggacgac
ggcgcctggcgcctgctgtccctgcgcccggacttctcaccggccgccaaggtccagacc
gaggacgacatcaccgcctcgatcgtggcccccggcggcctggtgtcgaccccggactcg
gagctgtcgcgcaagttcgtcaccaactgcgagtccctgctcttccagcggcccgacgac
gcgatcgtgcgcggctacgacaagcagaccgagtcggacatgtcggacccggacgcggac
ctgttcatctcgaacttcgagccgctcacgcccgaggacgcccgggcgatggccgccgac
gcccccggactgtcccgcttcacccagcccatgcaggacctcgtggcccgcgccgccgcc
ctgcccgaggccgaggaccccgccgaggagacctactgggtctccacggccgacccgcgc
ctggtgggcgggacccccaccaagaacccccgttacctccaggtgcgacccgacatcgcc
aacccgaaggacgtggcgctggcggacctcaccaaccacctcttccacgacgtgccgctg
gccgagccgctgcgccacagcgtcgacgtcgtcgccgccgggcgccgcaacaacccgccc
gaggacggggttccgccgctgtgcgcctacaacccgctgcactacatggagctgcccgag
ctgttcatggagttcatctcctccatgaccggcaagtccccctcgacgacgggtgccggc
agcgagggggcgctcaccaagtccccgttcaacgcgctgccggccatctacgacctcaac
gcggccctgctgtcctacgccctcagcggctacgacggctggctgtcctcggccggctac
atcggcccgaaggtccaggtggcccacgacatctcgctgctcatcccggagatcttctcc
cgcatgagcaccgaggagcgcgacgcccgcagcctcatcgagggcggctacctcgagcgc
atcgaggacttcgagtacgagggccgcactgttcaggcctcgcgtctgggctaccgcatg
aaccaggccttcgcctcgaccttcttcgggcggatcttcctgcaccccgacgtcgtcttc
accgaggagatgctgcgtcccgagctgcaggacgaggcggtcttcgccgactcggtggac
atcatcgtcaccacgcacaaggtcgtggccgagcactaccgggccgacggctccatcgag
tgggccgtgcctccgctgcgggccctgctggagatcatgatcgacggcacctcccgtgag
ggctgggacctgacgagcccggagttccgcgccctgttcgagcgcgagaacatcctgaac
tcgtcgtggtacgcggcgcgcctggacgccaaggtcgcccgcgacacccgccaggcgcac
caggccatcgaggacctcacccgcttctacaccgcggagaacaacgaggaggtcatcgag
cgcctgggcatcgaggggcgcctggccgaggcccgcgcctggctggacaaggtcagctcc
ccggcctaccgcgagcacctcgtgggcacgctcggcctccagccgaccctggcctga

DBGET integrated database retrieval system