KEGG   Azotobacter vinelandii CA6: AvCA6_13270Help
Entry
AvCA6_13270       CDS       T02634                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00473  D-Alanine metabolism
avd00550  Peptidoglycan biosynthesis
avd01100  Metabolic pathways
avd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AvCA6_13270 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AvCA6_13270 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AvCA6_13270 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avd01011]
    AvCA6_13270 (ddl)
Enzymes [BR:avd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AvCA6_13270 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:avd01011]
 Precursor biosynthesis
  Amino acid ligase
   AvCA6_13270 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_Ter TTL ATPgrasp_ST ATPgrasp_YheCD ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AGK17757
UniProt: M9YH69
LinkDB All DBs
Position
1291496..1292443
Genome map
AA seq 315 aa AA seqDB search
MNHALKSTLAPQAFGRVAVLFGGKSAERAVSLKSGQAVLEALQSAGVDAFGIDVGDDLLE
RLGRERIDRAFIVLHGRGGEDGSMQGLLECVGIPYTGSGVLASALAMDKLRTKQVWQSLG
LPTPRHAVPTSESDCRAAARDLGFPLIVKPAHEGSSIGMAKVNDIDELIAAWLSARSHDP
QVLVEQWIQGPEFTVALLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLDSSKEE
ELKALCARACEAVGVQGWARVDVMQDAEGRFWLLEVNTVPGMTDHSLVPMAARAAGLDFQ
QLVLAVLADSVEARG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgccctgaagtccacactggctccgcaagccttcggtcgtgtcgccgtactg
ttcggcggcaagagcgccgagcgggcggtctccctgaagtccggccaggccgtgctggaa
gcgctgcagagcgccggcgtggacgctttcggcatcgacgtcggcgacgacctgctcgag
cgactgggtcgcgagcggatcgatcgggccttcatcgtcctgcatggccgtggcggcgag
gatggcagcatgcagggcctgctcgaatgtgtcggcattccctacaccggcagcggcgtt
ctcgcttcggccctggcgatggacaagctgcgcaccaagcaggtctggcagagcctgggg
ttgccgacgccgcgccatgcggtgccgaccagcgagagcgactgccgggccgccgcacgg
gatctcggttttccgctgatcgtcaagccggcccacgaaggctcgagcatcggcatggcc
aaggtgaatgacatcgacgaactgatcgccgcctggctgtctgcccgctcccatgacccc
caggtgctggtcgagcagtggatccaggggccggagttcaccgtcgccctattgcgtggg
caggtgttacctccgatcggtctgggcacgccgcacagtttctacgattacgacgccaag
tatctggcctcggatacccagtaccggattccctgcgggctcgattccagcaaggaggag
gagttgaaggcgttgtgcgcgcgtgcctgcgaggcggtgggggtgcagggttgggcgcgg
gtcgacgtgatgcaggacgcggagggccgcttctggctgcttgaagtcaatacggtgccg
ggcatgaccgatcatagtctggtgccgatggccgcgcgtgccgcgggactggatttccag
caactggtgctggcggttctggccgacagcgtcgaggcaaggggctga

DBGET integrated database retrieval system