KEGG   Azotobacter vinelandii CA6: AvCA6_15420Help
Entry
AvCA6_15420       CDS       T02634                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00220  Arginine biosynthesis
avd00250  Alanine, aspartate and glutamate metabolism
avd00290  Valine, leucine and isoleucine biosynthesis
avd01100  Metabolic pathways
avd01110  Biosynthesis of secondary metabolites
avd01130  Biosynthesis of antibiotics
avd01210  2-Oxocarboxylic acid metabolism
avd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:avd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AvCA6_15420
   00290 Valine, leucine and isoleucine biosynthesis
    AvCA6_15420
   00220 Arginine biosynthesis
    AvCA6_15420
Enzymes [BR:avd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AvCA6_15420
    2.6.1.66  valine---pyruvate transaminase
     AvCA6_15420
Amino acid related enzymes [BR:avd01007]
 Aminotransferase (transaminase)
  Class I
   AvCA6_15420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Arc
Motif
Other DBs
NCBI-ProteinID: AGK19961
UniProt: M9YDJ2
LinkDB All DBs
Position
complement(1514221..1515432)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKKVEGIGIEDIYLGNGVSELIVMVLQALLNNGDE
VLIPAPDYPLWTAATSLAGGKAVHYLCDEQSNWYPDIADIEAKITRNTKALLLINPNNPT
GAVYPREVLERIVEVARQHNLVIFSDEIYDKILYDDAQHISTASLAPDVLCLTFNGLSKA
YRVAGFRSGWVAISGPRHKAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLIL
PGGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLQEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKTYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagtaaatcgaacaagctcgccaacgtctgctacgacattcgcgggccggtg
ctcaagcacgccaagcgtctggaggaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgttcggtttcgaggcccccgaggaaatcctccaggacgtgatccgcaac
ctgcccaccgcccagggctacagcgactccaaggggctgttcagcgcccgcaaggcggtg
atgcagtactaccagcagaagaaggtggaaggcatcggcatcgaggacatctacctgggc
aacggtgtgtccgagctgatcgtcatggtcctgcaggccctgctcaacaacggcgacgaa
gtgctgatcccggcgcccgactacccgctgtggacagcggccaccagcctggccggcggc
aaggcggtgcattacctgtgcgacgagcagtcgaactggtatcccgacatcgccgacatc
gaggccaagatcacccgcaacaccaaggcgctgctgctgatcaacccgaacaaccccacc
ggcgcggtctacccgcgggaagtgctcgagcggatcgtcgaggtcgcccggcagcacaac
cttgtgatcttctccgacgagatctacgacaagatcctctacgacgacgcccagcacatt
tccaccgcctccctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaggcc
taccgggtggcaggcttccgctccggctgggtagccatctccggtcccaggcacaaggcg
cagagctacatcgagggcctcgacatcctcgccaacatgcgcctgtgcgccaacgtaccg
gcccagcacgcgatccagaccgccctcggcggttaccagagcatcaacgacctgatcctg
cccggcggccgccttctggagcagcgcaaccgtacctgggagttgctcaacgacattccc
ggagtcagttgcgtcaagccgatgggcgcgctctacgcctttccgaagatcgaccccaag
gtctgcccgatccacaacgacgagaaattcgtcctcgacctgctgctgcaggaaaagctg
ctgatcgtccagggcaccgccttcaactggccgtggccggaccacttccgcgtggtcacc
ctgccgcgggtcgacgacctcgaacaggccatcggccgcatcggcaacttcctcaaaacc
taccgtcaataa

DBGET integrated database retrieval system