KEGG   Azotobacter vinelandii CA6: AvCA6_16390Help
Entry
AvCA6_16390       CDS       T02634                                 

Gene name
fadB2
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00071  Fatty acid degradation
avd00280  Valine, leucine and isoleucine degradation
avd00281  Geraniol degradation
avd00310  Lysine degradation
avd00362  Benzoate degradation
avd00380  Tryptophan metabolism
avd00410  beta-Alanine metabolism
avd00640  Propanoate metabolism
avd00650  Butanoate metabolism
avd00903  Limonene and pinene degradation
avd00930  Caprolactam degradation
avd01100  Metabolic pathways
avd01110  Biosynthesis of secondary metabolites
avd01120  Microbial metabolism in diverse environments
avd01130  Biosynthesis of antibiotics
avd01200  Carbon metabolism
avd01212  Fatty acid metabolism
Module
avd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AvCA6_16390 (fadB2)
   00650 Butanoate metabolism
    AvCA6_16390 (fadB2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AvCA6_16390 (fadB2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AvCA6_16390 (fadB2)
   00310 Lysine degradation
    AvCA6_16390 (fadB2)
   00380 Tryptophan metabolism
    AvCA6_16390 (fadB2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AvCA6_16390 (fadB2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AvCA6_16390 (fadB2)
   00281 Geraniol degradation
    AvCA6_16390 (fadB2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA6_16390 (fadB2)
   00930 Caprolactam degradation
    AvCA6_16390 (fadB2)
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AvCA6_16390 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AvCA6_16390 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AvCA6_16390 (fadB2)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     AvCA6_16390 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGK17847
UniProt: M9YHG3
LinkDB All DBs
Position
1621349..1623481
Genome map
AA seq 710 aa AA seqDB search
MFNGKAMRLKALEAGLVELTLDLQGSSVNKLDRPTLDELAEVVRLLGTRGHEIEGLLIAS
AKPAFVVGADITEFTAAFARPESEVADWIGYGQRLFSALERLPFPSVAAVNGLALGGGFE
LALAADFRVLAADARVGLPEVTLGLCPGWGGTVRLSRLIGAEAALDWMLAGKPQAAARAL
ELGAVDRVVLAAELRDVALNLLRLAASGELSGAAERSRKQQPLGDSQERLAALRQRLGGK
LDARYPAPAAILDAVIRHAGLPLDEALRVEVRTFGALAKSDVARALIGLFLGEQLVRKKA
RAWSGKAEPVRRSAVLGAGIMGGGVAFQSASSGVPIVMKDIRGEALELGLKTAGQLLDRQ
IDKGRLDAAGKQRVLDNIRPALDYAGFGEVDLVVEAVVENPRVKAAVLAEVEDQVAANAV
LTSNTSTISIDLLARGLKRPEAFCGMHFFNPVQLMQLVEVIRGSRSSEATIARTVAYASA
MGKTPIVVGDCPGFLVNRVLFPYFNGFNRLLRDGVDFERIDRVMEAFGWPMGPAYLADVV
GIDTMVHADHVLQEGFPERMGHDGEPIMDALLASGALGQKNGRGFYEYTVDASGRRGKQP
AAAARALIAGRVVEAVEVSDEEIVDRLMIPLCLEAVRCLEDGIVETPEEIDMGLLLGIGF
PRFRGGALRYIDTQGLAVFAAKAEAHARHGGLYRLTEDFRARLAAGRGYF
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacggcaaggcgatgcgcctcaaggcactggaggcggggctggtcgagctgacc
ctcgatctgcagggctcctccgtcaacaagctggaccggccgaccctggacgagctggcc
gaagtcgtccggctgctcggtacccgcggccacgagatcgagggtctgctgatcgccagt
gccaagccggcgttcgtggtcggcgccgacatcaccgaattcaccgcggccttcgcccgt
cccgagagcgaggtggcggactggatcggctacgggcagcgactgttctccgccctggag
cgcctgccgttcccgagcgtggcggcggtgaacggcctggcgctgggcggcggcttcgag
ctggcgctggcggccgatttccgggtgctggcggcggatgccagggtcggcctgccggag
gtgaccctgggcctctgtccgggttggggcggcaccgttcgcctgagccggctgatcggc
gccgaggcggcgctcgactggatgctcgccggcaagccgcaggccgcggccagggcgctg
gagctgggcgccgtcgaccgggtggtgctcgccgcggagctgcgcgatgtcgcgctgaac
ctgctgcgcctggccgccagtggcgagctgtcgggcgccgccgagcgctcccgcaagcag
cagcccctcggcgacagtcaggaacgcctggccgctctccggcaacgcctcggcggcaag
ctcgatgcccgttatccagcgccggcggcgatcctcgatgcggtgatccgccatgccggg
ctgccgctggacgaggcgctgcgggtcgaggtgcgtaccttcggcgcgctggccaagtcg
gatgtcgcccgcgcgctgatcggcctgttcctcggcgagcaactggtcaggaagaaggcc
agggcctggagcggcaaggccgagccggtccgccgcagcgccgtgctcggcgccggcatc
atgggcggcggcgtggccttccagtcggcgtcctcgggcgtgcccatcgtcatgaaagac
atccgcggcgaggcgctcgaactgggcctgaagaccgccgggcaactgctcgaccggcag
atcgacaagggccgcctggatgccgccggcaagcagcgagtgctggacaacatccggccg
gcgctggactacgcgggcttcggcgaagtcgacctggtggtcgaggcggtggtcgagaat
cccagggtcaaggccgccgtgctggccgaggtggaggaccaggtggcggcgaacgcggtg
ctgacctccaacacctcgaccatctccatcgacctgctggcgcggggcctgaagcggccg
gaagccttctgcggcatgcacttcttcaacccggtgcaactgatgcaactggtcgaggtg
atccgcggcagccgcagcagcgaggcgaccatcgcccgcaccgtggcctacgccagcgcc
atgggcaagacgcccatcgtggtcggcgactgtccgggctttctggtcaaccgggtgctc
ttcccctatttcaacggcttcaaccgcctgctcagggacggcgtcgacttcgagcgcatc
gaccgggtcatggaagccttcggctggccgatgggcccggcctacctggccgacgtggtc
ggcatcgacaccatggtccacgccgaccatgtgctgcaggagggtttccccgagcgcatg
ggccacgacggcgagccgatcatggatgcgctgctggccagcggcgcgctcggccagaag
aacggccggggtttctacgaatacaccgtcgacgcctccggacggcgcggcaagcagccg
gccgcggcggcccgcgcgttgatcgccgggcgggtggtcgaggccgtggaggtttccgac
gaggaaatcgtcgaccggctgatgatcccgctgtgcctggaggcggtgcgctgcctggag
gacggcatcgtcgagacgcccgaggagatcgacatggggctgctgctcggcatcggcttc
ccgcgctttcgcggcggcgccctgcgctacatcgacacccagggcctggcggtcttcgcc
gccaaggccgaggcccacgcccgtcatggcgggctctaccgcctgaccgaggatttccgc
gcccgcctggccgccggccggggctatttctga

DBGET integrated database retrieval system